(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE310

MICSR_1.PE310        Location/Qualifiers
FT   CDS             join(complement(614732..614983),complement(614513..614698),
FT                   complement(613643..614428))
FT                   /codon_start=1
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636940"
FT                   /gene_name="PEX12"
FT                   /orf_name="MICPUN_80117"
FT                   /product="Peroxisomal protein importer family "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="ACO62174.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560128"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A6CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I7"
FT                   /transl_table=1
FT                   /translation="MQFQVDAGDSRPTFFELVATDRLVPSLRAALVYSLRTLAERRPGV
FT                   TRILDHEAEAFALLMLLVEAHSFATSDGSLAEGLYGLQRRGGRGGRGGRAAVARGGLLR
FT                   SGDDDGGNGARRSRRIGGKQRLLSVLVLVGLPYAREKLDALYPPGRSSRDEGARDGDDD
FT                   DARGGRRARGGSSPTPAAPSSSSSASAVSGASVRAGAAAAFVSAYPWIHAGWEAVVFWC
FT                   WLRYLLKDGTTHDPSLATLRLAVVRASPSEVTARRARVESARASRVNRLSSSPSWMTRV
FT                   VGPTALRAGHFALDHAQGGLMAAVVGFKLLEWWYGSAEDAVFRDRSHPPPPPPPRTAPH
FT                   PRARCVVPRDPALCPLCRRRCSQPAVVRTSGWVFCHPCVVDEVRRFGRCPVTLAAAAEG
FT                   DVVRLFSE"
     MQFQVDAGDS RPTFFELVAT DRLVPSLRAA LVYSLRTLAE RRPGVTRILD HEAEAFALLM        60
     LLVEAHSFAT SDGSLAEGLY GLQRRGGRGG RGGRAAVARG GLLRSGDDDG GNGARRSRRI       120
     GGKQRLLSVL VLVGLPYARE KLDALYPPGR SSRDEGARDG DDDDARGGRR ARGGSSPTPA       180
     APSSSSSASA VSGASVRAGA AAAFVSAYPW IHAGWEAVVF WCWLRYLLKD GTTHDPSLAT       240
     LRLAVVRASP SEVTARRARV ESARASRVNR LSSSPSWMTR VVGPTALRAG HFALDHAQGG       300
     LMAAVVGFKL LEWWYGSAED AVFRDRSHPP PPPPPRTAPH PRARCVVPRD PALCPLCRRR       360
     CSQPAVVRTS GWVFCHPCVV DEVRRFGRCP VTLAAAAEGD VVRLFSE                     407
//

If you have problems or comments...

PBIL Back to PBIL home page