(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE311

MICSR_1.PE311        Location/Qualifiers
FT   CDS             join(615284..616504,616637..618490)
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636941"
FT                   /orf_name="MICPUN_79480"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61749.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A6CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I8"
FT                   /transl_table=1
FT                   /translation="MEDLVNDPHAEEIVVRENYGRDGAAEIGAIARGLRLHFRQYGKGT
FT                   NTALVASKVPLPDYRADLDGRRRAEHEVDMSPDTMAIVARALHDSPSVEDLSANLGSLT
FT                   HASQSKRQRGDGDRSRSRVDEASHLLRRDAAVDAAAQKAELERLESPHVAARMAQRARL
FT                   PAFERRDELLAAVDACTNVLVVSGETGCGKTTQLPQFVLERALASGDASVTGILCTQPR
FT                   RISAISVAARVAQERGEELGESVGYQIRLEARRSAATRLLFCTTGVLLRRLAVEPTLDS
FT                   VSHVFVDEIHERGMNEDFLLVVLRDLLPRRPDLKIVLMSATLDAGLFAAYFGGAPVAHI
FT                   PGFTYNVRTLFLEDALEAFGTRLVVSPPDARRDGFGGFGGKRRGRFGGGRREPTPGYNP
FT                   DEDEDGGDNLVATLVATCDPADPDGDGAILVFLTGWDEITKVNDLMRADPLLGDRTKCA
FT                   VLPLHGAMPTANQREIFDRPPRGVRKIILSTNIAETSITIDDVTHVVDCGKSKEKTYDA
FT                   LNNLACLQPAWISKASAHQRRGRAGRVREGVCYRLYTKAQHAKMADHATPELLRTPLEE
FT                   LCLTIKSLGLGLCEPFIARALQPPEPKSVHNAIELLITIGALSRRTEELTPLGRHLAAL
FT                   PVDPRVGKMLVTAATFGCLSPALTIAAGMAYKDPFVLPMDKKHQADAVRRRLAGDTRSD
FT                   HIALVRAFEGWTRARRDGGNREGWEYCRRNFLSGNTLELMSDMRRQFADLLHGIGFLPD
FT                   GARSADRVDAAHNRHAADVAMLRAVICAGMYPRLVSVRPRGRRNELKTHEDGKVECHPS
FT                   SVNSEFGVSFPFPWLVYCEKVKTSGVYIRDSTCVPAYAVLLLGGDLDEEPDGTAGDGDD
FT                   DVGIRVCGGHYTFSAPRDVLALVRKLRREIDSLLDAKARNPGLGGFGCGFVDAMRALVA
FT                   DEEHRAYGGDDRGRDRGGGGGDRGGGWGRRGGRGGFGGAPGTSGGDWECSNGCGLVFGG
FT                   KRSCFRCGAPREGDRGDGGRGGLGGGPPAPRHVRF"
     MEDLVNDPHA EEIVVRENYG RDGAAEIGAI ARGLRLHFRQ YGKGTNTALV ASKVPLPDYR        60
     ADLDGRRRAE HEVDMSPDTM AIVARALHDS PSVEDLSANL GSLTHASQSK RQRGDGDRSR       120
     SRVDEASHLL RRDAAVDAAA QKAELERLES PHVAARMAQR ARLPAFERRD ELLAAVDACT       180
     NVLVVSGETG CGKTTQLPQF VLERALASGD ASVTGILCTQ PRRISAISVA ARVAQERGEE       240
     LGESVGYQIR LEARRSAATR LLFCTTGVLL RRLAVEPTLD SVSHVFVDEI HERGMNEDFL       300
     LVVLRDLLPR RPDLKIVLMS ATLDAGLFAA YFGGAPVAHI PGFTYNVRTL FLEDALEAFG       360
     TRLVVSPPDA RRDGFGGFGG KRRGRFGGGR REPTPGYNPD EDEDGGDNLV ATLVATCDPA       420
     DPDGDGAILV FLTGWDEITK VNDLMRADPL LGDRTKCAVL PLHGAMPTAN QREIFDRPPR       480
     GVRKIILSTN IAETSITIDD VTHVVDCGKS KEKTYDALNN LACLQPAWIS KASAHQRRGR       540
     AGRVREGVCY RLYTKAQHAK MADHATPELL RTPLEELCLT IKSLGLGLCE PFIARALQPP       600
     EPKSVHNAIE LLITIGALSR RTEELTPLGR HLAALPVDPR VGKMLVTAAT FGCLSPALTI       660
     AAGMAYKDPF VLPMDKKHQA DAVRRRLAGD TRSDHIALVR AFEGWTRARR DGGNREGWEY       720
     CRRNFLSGNT LELMSDMRRQ FADLLHGIGF LPDGARSADR VDAAHNRHAA DVAMLRAVIC       780
     AGMYPRLVSV RPRGRRNELK THEDGKVECH PSSVNSEFGV SFPFPWLVYC EKVKTSGVYI       840
     RDSTCVPAYA VLLLGGDLDE EPDGTAGDGD DDVGIRVCGG HYTFSAPRDV LALVRKLRRE       900
     IDSLLDAKAR NPGLGGFGCG FVDAMRALVA DEEHRAYGGD DRGRDRGGGG GDRGGGWGRR       960
     GGRGGFGGAP GTSGGDWECS NGCGLVFGGK RSCFRCGAPR EGDRGDGGRG GLGGGPPAPR      1020
     HVRF                                                                   1024
//

If you have problems or comments...

PBIL Back to PBIL home page