(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE312

MICSR_1.PE312        Location/Qualifiers
FT   CDS             join(complement(619272..619457),complement(618864..619010))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636942"
FT                   /orf_name="MICPUN_56889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62175.1"
FT                   /db_xref="UniParc:UPI000199A6CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I9"
FT                   /transl_table=1
FT                   /translation="MSGLDEYDYLIYPGFMRRPMARWNEDGSVAPMARARGPKGEAFQL
FT                   TLKQSEIDEDIAHIEYEIGIGKKPKKKRTGPPLNPKLEAVKKQEEEERVASESEREEQD
FT                   GDSDKK"
     MSGLDEYDYL IYPGFMRRPM ARWNEDGSVA PMARARGPKG EAFQLTLKQS EIDEDIAHIE        60
     YEIGIGKKPK KKRTGPPLNP KLEAVKKQEE EERVASESER EEQDGDSDKK                  110
//

If you have problems or comments...

PBIL Back to PBIL home page