(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE313

MICSR_1.PE313        Location/Qualifiers
FT   CDS             complement(619591..619782)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636943"
FT                   /orf_name="MICPUN_56890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62176.1"
FT                   /db_xref="UniParc:UPI000199A6CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J0"
FT                   /transl_table=1
FT                   /translation="MQGDARVSAADIKVTADLDRGCVLGRPKGPTFVSARDADEAGSQR
FT                   HDRRTQAGSRKRFAGKVN"
     MQGDARVSAA DIKVTADLDR GCVLGRPKGP TFVSARDADE AGSQRHDRRT QAGSRKRFAG        60
     KVN                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page