(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE314

MICSR_1.PE314        Location/Qualifiers
FT   CDS             <619880..>620776
FT                   /codon_start=1
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636944"
FT                   /orf_name="MICPUN_70956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61750.1"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199A6CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J1"
FT                   /transl_table=1
FT                   /translation="ETTVVSAEWLKANIGRPDVVVLDCSWYLPAMERDPRAEHEAKRVP
FT                   GARFFDVDGVSDPSSPLPHMLPDAGAFAAACDAVGVANGDQVVVYDGAGLFSAARGWWM
FT                   FKVFGHDAVALLDGGMRAWEKLDGATVETKPPAVPIAAATDACARWYDDASKPSSTPSS
FT                   SFRATLRPELVLRRDDVLARCVGAAATETLVDARPKPRWAGEAPEPRAGIRSGRVPGSA
FT                   CVPFFDVLDADDRTFKSRDEIRDVFSAAGADVTGAKKVVASCGTGVTACVLSLGAAIAR
FT                   GDGTPLPVYDGSWTEWGA"
     ETTVVSAEWL KANIGRPDVV VLDCSWYLPA MERDPRAEHE AKRVPGARFF DVDGVSDPSS        60
     PLPHMLPDAG AFAAACDAVG VANGDQVVVY DGAGLFSAAR GWWMFKVFGH DAVALLDGGM       120
     RAWEKLDGAT VETKPPAVPI AAATDACARW YDDASKPSST PSSSFRATLR PELVLRRDDV       180
     LARCVGAAAT ETLVDARPKP RWAGEAPEPR AGIRSGRVPG SACVPFFDVL DADDRTFKSR       240
     DEIRDVFSAA GADVTGAKKV VASCGTGVTA CVLSLGAAIA RGDGTPLPVY DGSWTEWGA        299
//

If you have problems or comments...

PBIL Back to PBIL home page