(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE315

MICSR_1.PE315        Location/Qualifiers
FT   CDS             complement(620909..622051)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636945"
FT                   /orf_name="MICPUN_56892"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62177.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG608966"
FT                   /db_xref="InterPro:IPR010675"
FT                   /db_xref="UniParc:UPI000199A6D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J2"
FT                   /transl_table=1
FT                   /translation="MEEAPGAEEAPEAAPASRAATKKRSREDRDAAGASNPPSGLDAWA
FT                   EEATANRGGAGAASSAGGDGRGGGDAAPASHVKFGGANGGGRDANGRQRQCFRYGNYHR
FT                   YYGYRVGESLEDHRIAHLKREWFHRKRCVDVGCNEGLVSLSIAVSFGSTTMLGIDIDEW
FT                   LVKKAREKLRRMRRAAAKAATKAERESEEAARMAAEASAREADAAAGGTLRSHPATRVA
FT                   AATETTDGTGEVGSQLGAKLADSGPSLGGVTFRASNILDETFEPGSVDAFLCLSVTKWI
FT                   QLNWGDAGLKKMFKQIYDALSPGGVFIVEPQPWKSYKQAFRKQKMPEETREHFRGIELR
FT                   PAFFAEHLRQVVGFSSVQAIRSADLHVADEFDRNLLLCVK"
     MEEAPGAEEA PEAAPASRAA TKKRSREDRD AAGASNPPSG LDAWAEEATA NRGGAGAASS        60
     AGGDGRGGGD AAPASHVKFG GANGGGRDAN GRQRQCFRYG NYHRYYGYRV GESLEDHRIA       120
     HLKREWFHRK RCVDVGCNEG LVSLSIAVSF GSTTMLGIDI DEWLVKKARE KLRRMRRAAA       180
     KAATKAERES EEAARMAAEA SAREADAAAG GTLRSHPATR VAAATETTDG TGEVGSQLGA       240
     KLADSGPSLG GVTFRASNIL DETFEPGSVD AFLCLSVTKW IQLNWGDAGL KKMFKQIYDA       300
     LSPGGVFIVE PQPWKSYKQA FRKQKMPEET REHFRGIELR PAFFAEHLRQ VVGFSSVQAI       360
     RSADLHVADE FDRNLLLCVK                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page