(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE316

MICSR_1.PE316        Location/Qualifiers
FT   CDS             622478..624277
FT                   /codon_start=1
FT                   /gene_family="HOG000264576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636946"
FT                   /orf_name="MICPUN_56893"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61751.1"
FT                   /db_xref="HOGENOM:HBG560131"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199A748"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J3"
FT                   /transl_table=1
FT                   /translation="MSFRKGLVEIWEDMMSYRTLKVVKISDKRLAYVHKSLMASILVYA
FT                   TITMVGAHTYMLKEKPRLYVTTTVDDTNRLSNWTLDSTSGPRGYCNSAYTSFPGDEFVP
FT                   EPAYPQTRCASYISTAQMVSVTDQGAFIGTHMRQQAWKRTCTDETTKLDCVVENKDENG
FT                   AAVDAEDHFAADIENIVLKLQPIYVTSWGVSEPAHRITVVNAAGQEVKEFERYGTDSTS
FT                   QWPTFTLKELLKLAEMDIDAQNPIIVSKNFKGLDAETGQPRLPLYRLTGLRIAVDFTFS
FT                   NFRPMGQMKPFDFTPLAVMTVKATSVGSFVTPRESTIYSGTTSNFDSQGTTLSIRGVKI
FT                   EYQAKGLMGKADGYTGMMALMSCLVMVGVATAIVDVIGAFIYDSFKDDKIEDDSERQHL
FT                   EHMILNIETSGVPFKNDDFEFEPGTSVKKQIDELTRDIQRQATLLHHMSGELAAAGLNS
FT                   HTMHMADLGEGVQSARYECVLKGPNGEDIFLTGGPQTVGRGHGGTQSKRISHKQISVVA
FT                   NTHNGMARVQGLPTKNISGVALGGGPWQPLGPEASVDLKNGDMIALLMDEGADEAETTV
FT                   DGVFRFQATYVEDKQQGGSWFGW"
     MSFRKGLVEI WEDMMSYRTL KVVKISDKRL AYVHKSLMAS ILVYATITMV GAHTYMLKEK        60
     PRLYVTTTVD DTNRLSNWTL DSTSGPRGYC NSAYTSFPGD EFVPEPAYPQ TRCASYISTA       120
     QMVSVTDQGA FIGTHMRQQA WKRTCTDETT KLDCVVENKD ENGAAVDAED HFAADIENIV       180
     LKLQPIYVTS WGVSEPAHRI TVVNAAGQEV KEFERYGTDS TSQWPTFTLK ELLKLAEMDI       240
     DAQNPIIVSK NFKGLDAETG QPRLPLYRLT GLRIAVDFTF SNFRPMGQMK PFDFTPLAVM       300
     TVKATSVGSF VTPRESTIYS GTTSNFDSQG TTLSIRGVKI EYQAKGLMGK ADGYTGMMAL       360
     MSCLVMVGVA TAIVDVIGAF IYDSFKDDKI EDDSERQHLE HMILNIETSG VPFKNDDFEF       420
     EPGTSVKKQI DELTRDIQRQ ATLLHHMSGE LAAAGLNSHT MHMADLGEGV QSARYECVLK       480
     GPNGEDIFLT GGPQTVGRGH GGTQSKRISH KQISVVANTH NGMARVQGLP TKNISGVALG       540
     GGPWQPLGPE ASVDLKNGDM IALLMDEGAD EAETTVDGVF RFQATYVEDK QQGGSWFGW        599
//

If you have problems or comments...

PBIL Back to PBIL home page