(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE318

MICSR_1.PE318        Location/Qualifiers
FT   CDS             complement(626801..627634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636948"
FT                   /orf_name="MICPUN_56895"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62178.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199A74A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J5"
FT                   /transl_table=1
FT                   /translation="MRTHAFRLGAVLFLALATTGAFAGDCTGLLNCNDCASIAAISNHK
FT                   CLNGGTCNAAYASSDDKVCICPSSTEGVECQTPGVTRCAGGSWCGNNGECGTNFRCKCT
FT                   VGFTGNRCEESQPPDNCVIPSNHQCLNGGKCTNNTNTPCNCPPNVGGPSCEKVDVRVCV
FT                   DGTYCENGGDCKVSGGCACDEGFIGATCGEVDREWFQARYNSGGGSSSSKKEVVNVAAA
FT                   VAVPLVLIIAAGGGFMAYMVHKERKGAPLFSKIDDVPDVEMSARNALPAPAVAKA"
     MRTHAFRLGA VLFLALATTG AFAGDCTGLL NCNDCASIAA ISNHKCLNGG TCNAAYASSD        60
     DKVCICPSST EGVECQTPGV TRCAGGSWCG NNGECGTNFR CKCTVGFTGN RCEESQPPDN       120
     CVIPSNHQCL NGGKCTNNTN TPCNCPPNVG GPSCEKVDVR VCVDGTYCEN GGDCKVSGGC       180
     ACDEGFIGAT CGEVDREWFQ ARYNSGGGSS SSKKEVVNVA AAVAVPLVLI IAAGGGFMAY       240
     MVHKERKGAP LFSKIDDVPD VEMSARNALP APAVAKA                                277
//

If you have problems or comments...

PBIL Back to PBIL home page