(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE319

MICSR_1.PE319        Location/Qualifiers
FT   CDS             627909..628442
FT                   /codon_start=1
FT                   /gene_family="HOG000019780" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636949"
FT                   /orf_name="MICPUN_56896"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO61753.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG704211"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI000199A74B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J6"
FT                   /transl_table=1
FT                   /translation="MKHGRHFRKLGKDASHRWAMMRTMVTQLIEHERIQTTVAKAKELR
FT                   RVADRVVTFAKEGSLRARRKAAAVVRTDAMVNKLFTELAERYKERPGGFTRVLQIGQRK
FT                   SDSAAMAYIEYVDRDGELRPARPATGFGLSWAAKEYVNSQLASKKRHGDVRAVLSPAAD
FT                   AAAKAAAEPPKEEK"
     MKHGRHFRKL GKDASHRWAM MRTMVTQLIE HERIQTTVAK AKELRRVADR VVTFAKEGSL        60
     RARRKAAAVV RTDAMVNKLF TELAERYKER PGGFTRVLQI GQRKSDSAAM AYIEYVDRDG       120
     ELRPARPATG FGLSWAAKEY VNSQLASKKR HGDVRAVLSP AADAAAKAAA EPPKEEK          177
//

If you have problems or comments...

PBIL Back to PBIL home page