(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE320

MICSR_1.PE320        Location/Qualifiers
FT   CDS             complement(628656..629258)
FT                   /codon_start=1
FT                   /gene_family="HOG000264526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636950"
FT                   /orf_name="MICPUN_56897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62179.1"
FT                   /db_xref="HOGENOM:HBG560135"
FT                   /db_xref="UniParc:UPI000199A74C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J7"
FT                   /transl_table=1
FT                   /translation="MAPTDVPKKERSLSYRLHDALNVPLVGGLAIMCILGLLGLMDAHL
FT                   ITKIFISYIAVDTIWIVLSPSAVPRFAWAIVLHHVLTFLILLHPLRFPEHAIETCRDGI
FT                   VELNTFFLIARRQLTRGSLLNRACDLMYHLTLSIRFLWQPYLIYHFRIITHMNSTDRPG
FT                   GYTFREHYMVMVSQVLLCVFNILIVLPGLLPKKKKKA"
     MAPTDVPKKE RSLSYRLHDA LNVPLVGGLA IMCILGLLGL MDAHLITKIF ISYIAVDTIW        60
     IVLSPSAVPR FAWAIVLHHV LTFLILLHPL RFPEHAIETC RDGIVELNTF FLIARRQLTR       120
     GSLLNRACDL MYHLTLSIRF LWQPYLIYHF RIITHMNSTD RPGGYTFREH YMVMVSQVLL       180
     CVFNILIVLP GLLPKKKKKA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page