(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE321

MICSR_1.PE321        Location/Qualifiers
FT   CDS             join(629589..629651,629765..631954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636951"
FT                   /orf_name="MICPUN_56898"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO61754.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A74D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J8"
FT                   /transl_table=1
FT                   /translation="MGDDVVNVFADEFEHPPGETLDILRDESIVKTVVEPAPAGGFKTR
FT                   PSVGDQVSFTVRRVHAANAPTAGTVAQDAELERYLLGCGAQCRAVEVALETMREGEVAT
FT                   FLCKERHLPAPNIESVYPEEVTIRLAKIFRDVDLTPRPSPGGKLIKRRTRWGDAKTHGQ
FT                   TLYEPMTLSHSPRPGYGSDTGRDVARPGCRVIVYTKHKPTAVNANTGLDAEPWTPMEFT
FT                   LRSTAVDAPPCPDGVHEALELSLTLASPGERFEVTFPASVYGFADDRVDGTVESDAVAS
FT                   ARFAETYDTGGDLVTTEVHVRAVHPPAPFAPEHAGPGGWGGTKDVGLDGEDLWTMPKWE
FT                   RAHRAKAAKERGVALFKAGRHRAALRAYDVAIRLLTAPFAPLDLSKVEMPEWDPPSEQD
FT                   PLGKDPHLKLAERYGSNAWRGLADSGLGEGNENQVLLKATILNASLAASRRGDHATCEW
FT                   YCSKALAEDPMCVKGWFRRGRARVAMHRWDEAEDDLNRAERLQGDDEIAKELDVERKKL
FT                   AAGRKKSESGGAVAKAFRAVFGGGGGGAGEYPKPREMRRLVTGDLGIEAGPAHPTGRLD
FT                   TDEPGAQLDELLDETSPHTRMEHAFNKALHYEQIGLNEFVDSGMPIELYSEAELAPVGE
FT                   GHPTAQAVEKREYVVPFGEAEAAELDAEIAEREHDEELYDKMLNAAKRGNRVQRGTATH
FT                   NPWDRDGTKAVDELNMQFVKEYNEQKMEEAKEEMEAHKKQWHERKKRATGDDIALD"
     MGDDVVNVFA DEFEHPPGET LDILRDESIV KTVVEPAPAG GFKTRPSVGD QVSFTVRRVH        60
     AANAPTAGTV AQDAELERYL LGCGAQCRAV EVALETMREG EVATFLCKER HLPAPNIESV       120
     YPEEVTIRLA KIFRDVDLTP RPSPGGKLIK RRTRWGDAKT HGQTLYEPMT LSHSPRPGYG       180
     SDTGRDVARP GCRVIVYTKH KPTAVNANTG LDAEPWTPME FTLRSTAVDA PPCPDGVHEA       240
     LELSLTLASP GERFEVTFPA SVYGFADDRV DGTVESDAVA SARFAETYDT GGDLVTTEVH       300
     VRAVHPPAPF APEHAGPGGW GGTKDVGLDG EDLWTMPKWE RAHRAKAAKE RGVALFKAGR       360
     HRAALRAYDV AIRLLTAPFA PLDLSKVEMP EWDPPSEQDP LGKDPHLKLA ERYGSNAWRG       420
     LADSGLGEGN ENQVLLKATI LNASLAASRR GDHATCEWYC SKALAEDPMC VKGWFRRGRA       480
     RVAMHRWDEA EDDLNRAERL QGDDEIAKEL DVERKKLAAG RKKSESGGAV AKAFRAVFGG       540
     GGGGAGEYPK PREMRRLVTG DLGIEAGPAH PTGRLDTDEP GAQLDELLDE TSPHTRMEHA       600
     FNKALHYEQI GLNEFVDSGM PIELYSEAEL APVGEGHPTA QAVEKREYVV PFGEAEAAEL       660
     DAEIAEREHD EELYDKMLNA AKRGNRVQRG TATHNPWDRD GTKAVDELNM QFVKEYNEQK       720
     MEEAKEEMEA HKKQWHERKK RATGDDIALD                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page