(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE325

MICSR_1.PE325        Location/Qualifiers
FT   CDS             join(complement(637691..637729),complement(636263..637396))
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636955"
FT                   /orf_name="MICPUN_90239"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62182.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199A751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K2"
FT                   /transl_table=1
FT                   /translation="MDGPTDAEKLPVTIVTGFLGAGKTTLVNHILKGDHGKLIAVIENE
FT                   FGAVSIDDALVGENIKEQENIITMDNGCVCCTVRGDLVRALLTLKDKTKKFDHVIIETT
FT                   GLADPAPVAFTFFINPEIADHYRIDSILCLADAKHIGLHLEEEKPDGAVNEAVQQVAFA
FT                   DRILLNKIDLVSDTELAAVMEQVRSINGVAEVIKTTNSVVDLDKVLGVSSFSIEKTLEV
FT                   DPDFLEDEEGHAAATAAHDGAAADGGDHGHGHSHDGGKTECHEDHGHGHGHGEPAAKKP
FT                   RKKRHDLTGVSSVGILAEGELDFNQVNTFMMTVLQENAKSIYRSKGVLCFKDQGNTKFV
FT                   FQGVHEHINFGPSSVEWGADEPRVNRMVFIGRNLNRKELEEGFRACLVKD"
     MDGPTDAEKL PVTIVTGFLG AGKTTLVNHI LKGDHGKLIA VIENEFGAVS IDDALVGENI        60
     KEQENIITMD NGCVCCTVRG DLVRALLTLK DKTKKFDHVI IETTGLADPA PVAFTFFINP       120
     EIADHYRIDS ILCLADAKHI GLHLEEEKPD GAVNEAVQQV AFADRILLNK IDLVSDTELA       180
     AVMEQVRSIN GVAEVIKTTN SVVDLDKVLG VSSFSIEKTL EVDPDFLEDE EGHAAATAAH       240
     DGAAADGGDH GHGHSHDGGK TECHEDHGHG HGHGEPAAKK PRKKRHDLTG VSSVGILAEG       300
     ELDFNQVNTF MMTVLQENAK SIYRSKGVLC FKDQGNTKFV FQGVHEHINF GPSSVEWGAD       360
     EPRVNRMVFI GRNLNRKELE EGFRACLVKD                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page