(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE327

MICSR_1.PE327        Location/Qualifiers
FT   CDS             complement(639847..640569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636957"
FT                   /orf_name="MICPUN_107906"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62183.1"
FT                   /db_xref="UniParc:UPI000199A753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K4"
FT                   /transl_table=1
FT                   /translation="MSDGYAAAQARKEAYLASLILQDVEKRGEAVRERGVTAWAHRPRE
FT                   REQVNERFLRNTLRGVDSSNRRVEQQAVRSGSPAPGAGGAKRVRPEDVVVDHGRGGAGS
FT                   TRRGSEGTSSSSSSAAASSSDSEPDAKPSAGNGKGGMRDDELAEFLSRPRVKRGRGAVG
FT                   SRADEPGPFLPGGGAEHKVGGYSLVLANEETRRNDARIAAMRDEAKRKERKKAEKREKK
FT                   ERKRERKEGRSEKKKRRR"
     MSDGYAAAQA RKEAYLASLI LQDVEKRGEA VRERGVTAWA HRPREREQVN ERFLRNTLRG        60
     VDSSNRRVEQ QAVRSGSPAP GAGGAKRVRP EDVVVDHGRG GAGSTRRGSE GTSSSSSSAA       120
     ASSSDSEPDA KPSAGNGKGG MRDDELAEFL SRPRVKRGRG AVGSRADEPG PFLPGGGAEH       180
     KVGGYSLVLA NEETRRNDAR IAAMRDEAKR KERKKAEKRE KKERKRERKE GRSEKKKRRR       240
//

If you have problems or comments...

PBIL Back to PBIL home page