(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE328

MICSR_1.PE328        Location/Qualifiers
FT   CDS             641175..642533
FT                   /codon_start=1
FT                   /gene_family="HOG000264352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636958"
FT                   /orf_name="MICPUN_56905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61757.1"
FT                   /db_xref="HOGENOM:HBG560142"
FT                   /db_xref="UniParc:UPI000199A754"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K5"
FT                   /transl_table=1
FT                   /translation="MARGTGPSRRSNRPSSRALGNSALNTRGIARGERGTRGKSSRVAS
FT                   RATSNEDDEPPAPEPLLVIVEVDGVLCDVHCDLHRLAFNEAFVELGMEGASWSEERYLS
FT                   LLRTGGGTAEGMVERYFHFYGYPTPELRDPTAHIPDEVGQAAMSGSIRPEGWNAEGASV
FT                   AAQAAAIQAAASRNPLNRELLARRRLEWIDEVVAKKDERLRAIVSEGRLKLRKGALDFI
FT                   DECLLEDGAQVVFVGATASAPEEGVLDAVLEAIGPLRAAAITQCGGHEQIDGCEFQSFE
FT                   NYHANNIVKDITANGEVAAREEQLQAVNGDVDVRKEMQAMMKQRKGELLAEEIGGDLQR
FT                   QRFDSNVVVDSGVFCTSTRSVISAEAVRGMLEAKGFGKDRAIFVGASRTTCAEAGAAGV
FT                   FNVLARTAHQADSQITDVACVVDGFGGGGGLTLRYIKRRAAAWDGRAATMDET"
     MARGTGPSRR SNRPSSRALG NSALNTRGIA RGERGTRGKS SRVASRATSN EDDEPPAPEP        60
     LLVIVEVDGV LCDVHCDLHR LAFNEAFVEL GMEGASWSEE RYLSLLRTGG GTAEGMVERY       120
     FHFYGYPTPE LRDPTAHIPD EVGQAAMSGS IRPEGWNAEG ASVAAQAAAI QAAASRNPLN       180
     RELLARRRLE WIDEVVAKKD ERLRAIVSEG RLKLRKGALD FIDECLLEDG AQVVFVGATA       240
     SAPEEGVLDA VLEAIGPLRA AAITQCGGHE QIDGCEFQSF ENYHANNIVK DITANGEVAA       300
     REEQLQAVNG DVDVRKEMQA MMKQRKGELL AEEIGGDLQR QRFDSNVVVD SGVFCTSTRS       360
     VISAEAVRGM LEAKGFGKDR AIFVGASRTT CAEAGAAGVF NVLARTAHQA DSQITDVACV       420
     VDGFGGGGGL TLRYIKRRAA AWDGRAATMD ET                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page