(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE329

MICSR_1.PE329        Location/Qualifiers
FT   CDS             join(complement(644174..644852),complement(643871..643923))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636959"
FT                   /orf_name="MICPUN_99439"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62184.1"
FT                   /db_xref="UniParc:UPI000199A755"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K6"
FT                   /transl_table=1
FT                   /translation="MVIRVSNDVLVVPPFDCAWLSSPDAESLTTASSEGGEGIVVSFDA
FT                   KADSDVTVILKGRRTSKSELDSRPARRLDHWSGRQDDPAKVDASTYLVIIGSHRNSACV
FT                   IEKNGRVVELAKGPAVPLLPARGRDAFTRCFVSWYPKRGALVVGVGEHLRHAWVDPEPH
FT                   TDPICEIGLSTWDDYAQYRDIEVRALDPDGGSRVNSWSATPADSPRGGRRPAPPPAVAD
FT                   VENLRGATRCARCCRTFGSPR"
     MVIRVSNDVL VVPPFDCAWL SSPDAESLTT ASSEGGEGIV VSFDAKADSD VTVILKGRRT        60
     SKSELDSRPA RRLDHWSGRQ DDPAKVDAST YLVIIGSHRN SACVIEKNGR VVELAKGPAV       120
     PLLPARGRDA FTRCFVSWYP KRGALVVGVG EHLRHAWVDP EPHTDPICEI GLSTWDDYAQ       180
     YRDIEVRALD PDGGSRVNSW SATPADSPRG GRRPAPPPAV ADVENLRGAT RCARCCRTFG       240
     SPR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page