(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE33

MICSR_1.PE33         Location/Qualifiers
FT   CDS             join(complement(60082..60114),complement(59732..59846),
FT                   complement(59417..59508),complement(58729..59286))
FT                   /codon_start=1
FT                   /gene_family="HOG000264788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636038"
FT                   /orf_name="MICPUN_107852"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62045.1"
FT                   /db_xref="HOGENOM:HBG560144"
FT                   /db_xref="UniParc:UPI000199AB29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R0"
FT                   /transl_table=1
FT                   /translation="MDKASLRLSGRVAAHGNGRIGNEKFTLTASTGFANGGTVTLRATP
FT                   GFSPKYDENEKKLNFQGDAISNVGDIGKLSEIDVQFSKSGVELAGQACDVTVARDHAEG
FT                   DNAAPSGVRIKSNVDKVGDVTITAIQAGHKTLNDEDARAEKNAIRIAADIPLSDVNADL
FT                   TGSVDYDLVSKNANVRIGYHKDDITVKLRTLIKEDGDKRTAASTINLDYSGLEGIGVGV
FT                   EVKDDKTGHLQITKDDFKLKVPIEENKVKTNDASITYNWAIDM"
     MDKASLRLSG RVAAHGNGRI GNEKFTLTAS TGFANGGTVT LRATPGFSPK YDENEKKLNF        60
     QGDAISNVGD IGKLSEIDVQ FSKSGVELAG QACDVTVARD HAEGDNAAPS GVRIKSNVDK       120
     VGDVTITAIQ AGHKTLNDED ARAEKNAIRI AADIPLSDVN ADLTGSVDYD LVSKNANVRI       180
     GYHKDDITVK LRTLIKEDGD KRTAASTINL DYSGLEGIGV GVEVKDDKTG HLQITKDDFK       240
     LKVPIEENKV KTNDASITYN WAIDM                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page