(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE330

MICSR_1.PE330        Location/Qualifiers
FT   CDS             644995..645621
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636960"
FT                   /orf_name="MICPUN_56907"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61758.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A756"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K7"
FT                   /transl_table=1
FT                   /translation="MAMKTTIWRPNVRVTLDEYGEVEDTERGGEEVTKQGTKRKRAPRP
FT                   KGPCEHGVKYRSRCKVCGACPHGKRRCYCKECGGASICEHGRQRSHCKECGGASICEHG
FT                   RQRHQCKECGGSGICEHGRHRFSCKECGGSGICEHGRIRSACKECGGGSFCEHGRQRSI
FT                   CKECGGAGICEHSRRRSQCKECGGGSICQHGRRRSQCKDCRGERL"
     MAMKTTIWRP NVRVTLDEYG EVEDTERGGE EVTKQGTKRK RAPRPKGPCE HGVKYRSRCK        60
     VCGACPHGKR RCYCKECGGA SICEHGRQRS HCKECGGASI CEHGRQRHQC KECGGSGICE       120
     HGRHRFSCKE CGGSGICEHG RIRSACKECG GGSFCEHGRQ RSICKECGGA GICEHSRRRS       180
     QCKECGGGSI CQHGRRRSQC KDCRGERL                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page