(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE331

MICSR_1.PE331        Location/Qualifiers
FT   CDS             complement(645707..649054)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636961"
FT                   /orf_name="MICPUN_56908"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62185.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A7BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K8"
FT                   /transl_table=1
FT                   /translation="MSTGAADPERVRTSITSMNALLDPLKHLYLNLADADGKTTRARCL
FT                   FALADTGILDDLPCADVGADLGHGFSDDVEVEWTYEDFVNVLGAAIAHRTAHRKPLPAA
FT                   PRGVAQRQLRDLFHLCCNDFDRARPKSNASRLTLHQWLVVCDGADLLTRRFTRDAAAVV
FT                   FARCRRGAETDLGLDQFITCLASLAVETGKTFEAVVSAVSTSPLCTGGAENVAPAKDIA
FT                   PGAAKDTYKTPGKVRVPTVFGGAKPKTPGAALKTPGASLKTPGASLKTPGASLKTPGAS
FT                   LKTPGASLKTPGASLKTPGAPNDVRYTAALESAVESPDAKSFETHDADGDGLLNRHELA
FT                   SLLAQGDSASVDGAIELVSKLFDDVDLDRDGRVCLAEYEAFCKKARRTLRRRTMSSAHG
FT                   PTASAPVPATYATDARLEEMFVAYCVVGAAKTPAKERTTNEGSVHVNNQNAFAAKRTID
FT                   ERRFLRVLKDAKLTGPGFLSQQQAQLCFHSQCARNERKLDHAGFLRALGAVVAHSGPGA
FT                   TYESIADAVKSLPIPDKLSAAVIERTIAPQPPARAGTGVGPRPHSARAGIGSFSTSSSS
FT                   SSGDSGFGARANAAVRTRPKSAKPRVSVSFADDDDVKSDVKSDVKSDVKSDVKSDVKSD
FT                   VKSESTAPDALLAAFDRRDAEANDGDVTGVASIGVCRLALADVAGLNGADAAAVADAFR
FT                   DVFEAFAVRAKLRREKLGEFKRKFDARVANLALAGAPLVPPVQVPPMSAPQSDAISGVF
FT                   DSTVGTSAGAPDFMTAAEFASLLSAAGLIDTDADADAVEVTFCRCVGGKPRGDADFASF
FT                   VTALAAIAGERRLTFFQVAAPVVDAAMRARAARGKEKEAGNETGDAAEPEAEPEPEAEP
FT                   EPEAAPEPEPEAAAAPEPEASEPEKAEAAQTAAPPLTEEERAVWAQEFKSHDEAESKSG
FT                   FVDVERVSFALAKLRLLEDVDVALAASELEASVKIVDPSGVGALDLDAFIAVGAAVRAL
FT                   KLGGRAKPSAKPVPVQREYVFDDSHPFAAKFRAVADVNGEIDGDSYRALLDRAGLLHDG
FT                   SRGSSETPETRLTNAGAAVVFARAKARHPGHGRRVPYRIFLGALSLSAGHLGMSFAEVV
FT                   ERIMATEL"
     MSTGAADPER VRTSITSMNA LLDPLKHLYL NLADADGKTT RARCLFALAD TGILDDLPCA        60
     DVGADLGHGF SDDVEVEWTY EDFVNVLGAA IAHRTAHRKP LPAAPRGVAQ RQLRDLFHLC       120
     CNDFDRARPK SNASRLTLHQ WLVVCDGADL LTRRFTRDAA AVVFARCRRG AETDLGLDQF       180
     ITCLASLAVE TGKTFEAVVS AVSTSPLCTG GAENVAPAKD IAPGAAKDTY KTPGKVRVPT       240
     VFGGAKPKTP GAALKTPGAS LKTPGASLKT PGASLKTPGA SLKTPGASLK TPGASLKTPG       300
     APNDVRYTAA LESAVESPDA KSFETHDADG DGLLNRHELA SLLAQGDSAS VDGAIELVSK       360
     LFDDVDLDRD GRVCLAEYEA FCKKARRTLR RRTMSSAHGP TASAPVPATY ATDARLEEMF       420
     VAYCVVGAAK TPAKERTTNE GSVHVNNQNA FAAKRTIDER RFLRVLKDAK LTGPGFLSQQ       480
     QAQLCFHSQC ARNERKLDHA GFLRALGAVV AHSGPGATYE SIADAVKSLP IPDKLSAAVI       540
     ERTIAPQPPA RAGTGVGPRP HSARAGIGSF STSSSSSSGD SGFGARANAA VRTRPKSAKP       600
     RVSVSFADDD DVKSDVKSDV KSDVKSDVKS DVKSDVKSES TAPDALLAAF DRRDAEANDG       660
     DVTGVASIGV CRLALADVAG LNGADAAAVA DAFRDVFEAF AVRAKLRREK LGEFKRKFDA       720
     RVANLALAGA PLVPPVQVPP MSAPQSDAIS GVFDSTVGTS AGAPDFMTAA EFASLLSAAG       780
     LIDTDADADA VEVTFCRCVG GKPRGDADFA SFVTALAAIA GERRLTFFQV AAPVVDAAMR       840
     ARAARGKEKE AGNETGDAAE PEAEPEPEAE PEPEAAPEPE PEAAAAPEPE ASEPEKAEAA       900
     QTAAPPLTEE ERAVWAQEFK SHDEAESKSG FVDVERVSFA LAKLRLLEDV DVALAASELE       960
     ASVKIVDPSG VGALDLDAFI AVGAAVRALK LGGRAKPSAK PVPVQREYVF DDSHPFAAKF      1020
     RAVADVNGEI DGDSYRALLD RAGLLHDGSR GSSETPETRL TNAGAAVVFA RAKARHPGHG      1080
     RRVPYRIFLG ALSLSAGHLG MSFAEVVERI MATEL                                 1115
//

If you have problems or comments...

PBIL Back to PBIL home page