(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE332

MICSR_1.PE332        Location/Qualifiers
FT   CDS             649408..650736
FT                   /codon_start=1
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636962"
FT                   /orf_name="MICPUN_52211"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="ACO61759.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199A7C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K9"
FT                   /transl_table=1
FT                   /translation="MALFGAGGSPAVCSSLYILDSNLKTLLMRDWRGDTNPSMVERFVS
FT                   IVNNAESESELKPIIYDDEIQTSFTYIRHRDLYFLALTRTNANAVALLTFLHRLVDIFT
FT                   HYFKELKEESIRDNFVIIYELLDEVMDNGYPQFTEAKILSEFITVGAHELQAPKAPMAV
FT                   TNAVSWRSEGLRYQKNEVFLDVVESCNCVVNANGQIVNSEVNGALRMRTQLSGMPECKL
FT                   GLNDKVMLQAQNKSTRGKSVELEDIKFHQCVRLARFESDRTISFIPPDGQFDLMNYRIT
FT                   TPVKPLIWVEAKVTRPSRSRVEYSVKLRTQFKSRLNATGIEVKLPVPGDATTPEVKAAL
FT                   GSVTYAPEQEAMLWKIKTVPGEKVVEMRAKFSLPSVSALEDDGPRQKKPPVMVKFEVPY
FT                   FTVSGVQVRFLKVIEKSGYQALPWVRYITKAGTYEFRLDHQSS"
     MALFGAGGSP AVCSSLYILD SNLKTLLMRD WRGDTNPSMV ERFVSIVNNA ESESELKPII        60
     YDDEIQTSFT YIRHRDLYFL ALTRTNANAV ALLTFLHRLV DIFTHYFKEL KEESIRDNFV       120
     IIYELLDEVM DNGYPQFTEA KILSEFITVG AHELQAPKAP MAVTNAVSWR SEGLRYQKNE       180
     VFLDVVESCN CVVNANGQIV NSEVNGALRM RTQLSGMPEC KLGLNDKVML QAQNKSTRGK       240
     SVELEDIKFH QCVRLARFES DRTISFIPPD GQFDLMNYRI TTPVKPLIWV EAKVTRPSRS       300
     RVEYSVKLRT QFKSRLNATG IEVKLPVPGD ATTPEVKAAL GSVTYAPEQE AMLWKIKTVP       360
     GEKVVEMRAK FSLPSVSALE DDGPRQKKPP VMVKFEVPYF TVSGVQVRFL KVIEKSGYQA       420
     LPWVRYITKA GTYEFRLDHQ SS                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page