(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE333

MICSR_1.PE333        Location/Qualifiers
FT   CDS             join(complement(651599..652086),complement(651282..651488),
FT                   complement(651137..651209))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636963"
FT                   /orf_name="MICPUN_56910"
FT                   /product="Fasciclin family protein "
FT                   /protein_id="ACO62186.1"
FT                   /db_xref="HOGENOM:HBG750250"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199A7C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L0"
FT                   /transl_table=1
FT                   /translation="MPHTKRPLLLAALALVAFAALFNPAAAGDTAAVGTMDPPKEDALL
FT                   MPTDAEADPAATDAAAKEMDMAPDMDMEPAAEEDAELKPLGETLQADPEFSTLVALVTA
FT                   AADESGATAEDLAAEGPFTLFAPVNEAFTKFLETSGLSVEDVLASPDLKEILSHHVVEG
FT                   KYTAADVLAMELPAEVPTLDGHTIKIDKTTDGDVLIAGNKVVAPDIEASNGVIHGIDGV
FT                   ITETTPEPEDTTTNEEVTSTALLGTLYAAVLVM"
     MPHTKRPLLL AALALVAFAA LFNPAAAGDT AAVGTMDPPK EDALLMPTDA EADPAATDAA        60
     AKEMDMAPDM DMEPAAEEDA ELKPLGETLQ ADPEFSTLVA LVTAAADESG ATAEDLAAEG       120
     PFTLFAPVNE AFTKFLETSG LSVEDVLASP DLKEILSHHV VEGKYTAADV LAMELPAEVP       180
     TLDGHTIKID KTTDGDVLIA GNKVVAPDIE ASNGVIHGID GVITETTPEP EDTTTNEEVT       240
     STALLGTLYA AVLVM                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page