(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE336

MICSR_1.PE336        Location/Qualifiers
FT   CDS             657228..658970
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636966"
FT                   /orf_name="MICPUN_56913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61761.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199A7C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L3"
FT                   /transl_table=1
FT                   /translation="MSTASAGSSGSIVIGARHGYARRTALRSSPGRRRLRTCAGKLSQR
FT                   KTRGSRGLSVVAEQHGISLEDARALFSKRFCKGSGVHLELQETPTGRGLVATAPVAPGD
FT                   VLITVPWREAIHVLEDGYSDGDDLRLALELLHVLDDGDEDGYIDGEYDARVKTWRKYRP
FT                   MLPVSTGAAAFWCVDNIRELQFPEAVEKTLAQRAEFTAGAMRHSNDSRTKERIMWALQQ
FT                   VHSRSFSVMTPQGRARCLVPYVDLFNHRPESPKEARMTDELLQRALRKAFTKGSEEGIN
FT                   DGEWAGAEPWQVVGPDPEDLENWEDAAVFQMRSIWAYEPGEEVFITYGHETSAELLTSY
FT                   GFFPEPNDGEFIRVYENVQDLIDDDRFVDEELNSPALQMEKEQFMWSMLAVEAPLAIRP
FT                   GGVRESAHLLSALRVVHARENQLAAMRDDDVPRIGHSTFVWTEGDEPCGMWDPDRFLSC
FT                   FFDESCDSDEWLWDDDDARDRDATDRAALAQACARCEEILRDDFATTLEEDQVMLDEIE
FT                   EAIRGLSPEEADEDPEGHLEYVAALRYRMSVKRILRDFISECKRAYGVEAEALKAEPEF
FT                   EYIE"
     MSTASAGSSG SIVIGARHGY ARRTALRSSP GRRRLRTCAG KLSQRKTRGS RGLSVVAEQH        60
     GISLEDARAL FSKRFCKGSG VHLELQETPT GRGLVATAPV APGDVLITVP WREAIHVLED       120
     GYSDGDDLRL ALELLHVLDD GDEDGYIDGE YDARVKTWRK YRPMLPVSTG AAAFWCVDNI       180
     RELQFPEAVE KTLAQRAEFT AGAMRHSNDS RTKERIMWAL QQVHSRSFSV MTPQGRARCL       240
     VPYVDLFNHR PESPKEARMT DELLQRALRK AFTKGSEEGI NDGEWAGAEP WQVVGPDPED       300
     LENWEDAAVF QMRSIWAYEP GEEVFITYGH ETSAELLTSY GFFPEPNDGE FIRVYENVQD       360
     LIDDDRFVDE ELNSPALQME KEQFMWSMLA VEAPLAIRPG GVRESAHLLS ALRVVHAREN       420
     QLAAMRDDDV PRIGHSTFVW TEGDEPCGMW DPDRFLSCFF DESCDSDEWL WDDDDARDRD       480
     ATDRAALAQA CARCEEILRD DFATTLEEDQ VMLDEIEEAI RGLSPEEADE DPEGHLEYVA       540
     ALRYRMSVKR ILRDFISECK RAYGVEAEAL KAEPEFEYIE                             580
//

If you have problems or comments...

PBIL Back to PBIL home page