(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE338

MICSR_1.PE338        Location/Qualifiers
FT   CDS             660248..661375
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636968"
FT                   /orf_name="MICPUN_56915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61762.1"
FT                   /db_xref="UniParc:UPI000199A7C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L5"
FT                   /transl_table=1
FT                   /translation="MAHFQHTCNACLKPICEGDVYITRCGHRFCERPRDRDLLASSPSS
FT                   LLAPLPSSRARARRLTTSAPPAVCTQATTTREGCVRRASARRAARRSTGRRISRCGACS
FT                   DRPRPSCAFFDRPFNRQAFAVRPGEEVSEALRGFDPGTIMTAAFNGINWWCEQAALVQE
FT                   MSSRRVQEEGRAHAEGYKSKLLEVHSAYKRAKAKAEALWQQMQQLELDKKELQSKYEQK
FT                   SGEKRRIEASYRELQSRGGVAGGGGGGGGGGHPRAPPSMPPPSRHAYQHMSSPPVHLGS
FT                   PPLDRNISRPASRPSMANFGGGNRPLLSGFPAGAAQTRPISPYSGDLMSPPQDYLDDRR
FT                   EWRRGGNRGAPRASRGGYRPPHSPTRSHHTFSIGN"
     MAHFQHTCNA CLKPICEGDV YITRCGHRFC ERPRDRDLLA SSPSSLLAPL PSSRARARRL        60
     TTSAPPAVCT QATTTREGCV RRASARRAAR RSTGRRISRC GACSDRPRPS CAFFDRPFNR       120
     QAFAVRPGEE VSEALRGFDP GTIMTAAFNG INWWCEQAAL VQEMSSRRVQ EEGRAHAEGY       180
     KSKLLEVHSA YKRAKAKAEA LWQQMQQLEL DKKELQSKYE QKSGEKRRIE ASYRELQSRG       240
     GVAGGGGGGG GGGHPRAPPS MPPPSRHAYQ HMSSPPVHLG SPPLDRNISR PASRPSMANF       300
     GGGNRPLLSG FPAGAAQTRP ISPYSGDLMS PPQDYLDDRR EWRRGGNRGA PRASRGGYRP       360
     PHSPTRSHHT FSIGN                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page