(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE339

MICSR_1.PE339        Location/Qualifiers
FT   CDS             complement(661547..662323)
FT                   /codon_start=1
FT                   /gene_family="HOG000166435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636969"
FT                   /orf_name="MICPUN_99445"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO62189.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560149"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000199A7C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L6"
FT                   /transl_table=1
FT                   /translation="MGLRDLLGLRRGDKGNNAAAAGRDAYSSEIISEAVPEQGASGSSI
FT                   LDEPVTSGFSTPAGMVSRADLAKMGTGASGVAYNPYTGLGGPFDPQMSKALYTITDSPE
FT                   LLFDEERRAKTRSWGENITFLTGVGYLGGIIAGGGLGAYKGLSSVPEAGLVDTQKLKLN
FT                   RVLNAAGSRGTSMGNAWGCLGLYYAALDSLVGHYTSHEYPALGAVVAGAGAGSLYKSAH
FT                   GMRAAAVYGVLGAGLSAANQAGQFLVGYGAATRPRW"
     MGLRDLLGLR RGDKGNNAAA AGRDAYSSEI ISEAVPEQGA SGSSILDEPV TSGFSTPAGM        60
     VSRADLAKMG TGASGVAYNP YTGLGGPFDP QMSKALYTIT DSPELLFDEE RRAKTRSWGE       120
     NITFLTGVGY LGGIIAGGGL GAYKGLSSVP EAGLVDTQKL KLNRVLNAAG SRGTSMGNAW       180
     GCLGLYYAAL DSLVGHYTSH EYPALGAVVA GAGAGSLYKS AHGMRAAAVY GVLGAGLSAA       240
     NQAGQFLVGY GAATRPRW                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page