(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE34

MICSR_1.PE34         Location/Qualifiers
FT   CDS             complement(<60993..>62148)
FT                   /codon_start=1
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636039"
FT                   /orf_name="MICPUN_68791"
FT                   /product="Predicted protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="ACO62046.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000199AB2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R1"
FT                   /transl_table=1
FT                   /translation="TDPDGPLAGLTFAVKDNLDVAGHRTGCGQPTWLDTHPEPARQHAP
FT                   PVASLLAAGAACVGKTQMDELAWALQGENHHYGTPINPAAPERVPGGSSSGSAVAVAAG
FT                   YADVALGTDTAGSVRVPASYCGLCGFRPTHGRVDATRGCVPLAPSFDVVGWFARDATTM
FT                   LRCGSVLLPPWGAWDTAFDLRFDGAIARDAFELCDEETRATLREAVARACGPGPLGEAG
FT                   GGTVEVDVGGGGSTPPLTEWWNVFRVIQANEVWRAHGAWVSEHQPRFGPGVKERFEGAG
FT                   GVTDAEAAEASKTRDAIAASMESTMVDEATGKDRFLFLPTSPGPPLASGADAQTVESFR
FT                   NRQLRLTAAAGLARLPQATVPVPRRSGPPLGLSVVGPRGTDEALL"
     TDPDGPLAGL TFAVKDNLDV AGHRTGCGQP TWLDTHPEPA RQHAPPVASL LAAGAACVGK        60
     TQMDELAWAL QGENHHYGTP INPAAPERVP GGSSSGSAVA VAAGYADVAL GTDTAGSVRV       120
     PASYCGLCGF RPTHGRVDAT RGCVPLAPSF DVVGWFARDA TTMLRCGSVL LPPWGAWDTA       180
     FDLRFDGAIA RDAFELCDEE TRATLREAVA RACGPGPLGE AGGGTVEVDV GGGGSTPPLT       240
     EWWNVFRVIQ ANEVWRAHGA WVSEHQPRFG PGVKERFEGA GGVTDAEAAE ASKTRDAIAA       300
     SMESTMVDEA TGKDRFLFLP TSPGPPLASG ADAQTVESFR NRQLRLTAAA GLARLPQATV       360
     PVPRRSGPPL GLSVVGPRGT DEALL                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page