(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE340

MICSR_1.PE340        Location/Qualifiers
FT   CDS             662781..>663746
FT                   /codon_start=1
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636970"
FT                   /orf_name="MICPUN_80010"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO61763.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199A7C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L7"
FT                   /transl_table=1
FT                   /translation="MHGPRGPPPDIAVEILASLIVSTVALLAGTVAVKALDPNRGAKKK
FT                   ADAMKRDIARRLGRPNIVTTPYEDMIATDVANPNAISTTFDEIGGLGETKRALQEIVIL
FT                   PLLRPELFSGGSLLKPVKGCMLYGPPGTGKTLLAKALAKECQACFINVRSSTLQSKWFG
FT                   DANKLVAAVFSLAWKLQPSIIFIDEVDSFLGARKGSEHEASTSMKTEFMTMWDGFQTNE
FT                   NARVMVLAATNRPWEVDEAILRRLPRSFEVGLPNLEQRIDIIKVILKDEHMEPGFFGPG
FT                   PDPPVLKIAKATDRYSGSDLKELCKSAAMGPIRDLLASEAR"
     MHGPRGPPPD IAVEILASLI VSTVALLAGT VAVKALDPNR GAKKKADAMK RDIARRLGRP        60
     NIVTTPYEDM IATDVANPNA ISTTFDEIGG LGETKRALQE IVILPLLRPE LFSGGSLLKP       120
     VKGCMLYGPP GTGKTLLAKA LAKECQACFI NVRSSTLQSK WFGDANKLVA AVFSLAWKLQ       180
     PSIIFIDEVD SFLGARKGSE HEASTSMKTE FMTMWDGFQT NENARVMVLA ATNRPWEVDE       240
     AILRRLPRSF EVGLPNLEQR IDIIKVILKD EHMEPGFFGP GPDPPVLKIA KATDRYSGSD       300
     LKELCKSAAM GPIRDLLASE AR                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page