(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE341

MICSR_1.PE341        Location/Qualifiers
FT   CDS             complement(664379..665470)
FT                   /codon_start=1
FT                   /gene_family="HOG000256919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636971"
FT                   /orf_name="MICPUN_56918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62190.1"
FT                   /db_xref="HOGENOM:HBG315524"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A7C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L8"
FT                   /transl_table=1
FT                   /translation="MDPMGLSAGPNILELYQKPVNITTYDTKWIPTSARFVVLGSYARA
FT                   TGCLQIYSLDTENEGVKLNKELEKKAAFKCGTFGASSLRERHLATGNFEGYLQLWDLQR
FT                   PEKPLMDVKAHTSIVNAIDGAGGQRSGYGPPELVTGGRDGCVRVWDVRQKDAPVAIFEP
FT                   AEGVKARDCWSVAFGNSFNDEERCVLAGYDNGDVKMFDLRTGTVRAEHNVRNGVCSVEF
FT                   DRKEIAMNKFVVTCLESAFTVFDARTQHPAKGFSSVTEKVPVSATVWGAKHLPQNREVS
FT                   MVLGGDGTLMLYKYQYPDQRVVKDKDGVKMGVAGTMNLVNSKNVSTQPISSWDWSPDKE
FT                   GLAVCGSFDQTVRVVCATRLNTL"
     MDPMGLSAGP NILELYQKPV NITTYDTKWI PTSARFVVLG SYARATGCLQ IYSLDTENEG        60
     VKLNKELEKK AAFKCGTFGA SSLRERHLAT GNFEGYLQLW DLQRPEKPLM DVKAHTSIVN       120
     AIDGAGGQRS GYGPPELVTG GRDGCVRVWD VRQKDAPVAI FEPAEGVKAR DCWSVAFGNS       180
     FNDEERCVLA GYDNGDVKMF DLRTGTVRAE HNVRNGVCSV EFDRKEIAMN KFVVTCLESA       240
     FTVFDARTQH PAKGFSSVTE KVPVSATVWG AKHLPQNREV SMVLGGDGTL MLYKYQYPDQ       300
     RVVKDKDGVK MGVAGTMNLV NSKNVSTQPI SSWDWSPDKE GLAVCGSFDQ TVRVVCATRL       360
     NTL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page