(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE342

MICSR_1.PE342        Location/Qualifiers
FT   CDS             665607..667811
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636972"
FT                   /orf_name="MICPUN_56919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61764.1"
FT                   /db_xref="UniParc:UPI000199A7CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L9"
FT                   /transl_table=1
FT                   /translation="MNRRGGVAALIALAMVTFVYLAYVSGVGNMYLPSESVASTTSSPV
FT                   GRVAIPARIANPSPPAPAPLVDERPEPAPEPRASPAPTSPAVVRDDRKDEGRKLPMECP
FT                   MVDVADPENVAAVARSLGDASDVVVFATQDIEHWRAEFLVNVILNLMSVNVTSVVTVGR
FT                   HKHTCESARRDNPDVVRCCVYSTWLDGHDALKRWTLAEDHAYVLWLIRYRFALDIMRAG
FT                   EVGVLVSDSDMWFERDPFELLKDAATGLGTHSVVANVEGEPFPSMNGGLVYFRADLPGK
FT                   GGRYLLEVFNDHVDDLLADESPPECHKEQGVGTQVVWGAMMDQDILRDAAETAVAGAPL
FT                   WWSYTHHVCLFKGGYDEATKAKMEIKSKHPETLDWSRSGRSLPRPFQSHPAVEALGDEH
FT                   PLNESEEKYGIMKVPNYETWRNLTILAAPKWMFANHGDGDGWFALRPRPGAAFHCMSQN
FT                   QGIKPRMLRAYDMWHWDVLGAGRGIRVGQGRYLSLASAAFGHFTKRGEFAMQAHRLAAL
FT                   AAATGRIPVLPMIPCASPWLDDWRRPDDCYAGVLERINVLAGTCPVTALRQFQGPDAAY
FT                   PGDPAAEGSVGSPCCYFVPPGDDCEEKFAAWGAEMTGEDPHNRPGRTVRLDAIIDAAQL
FT                   VVDAGDATEYADRSWVLGDDFPPDNAKHPTDVFVDFGRVVKAIEGDGDQNTPWVEIDMR
FT                   GKDALPRVVTQRGVDDKSRRKWFMDYNAACPLVNRVSPMV"
     MNRRGGVAAL IALAMVTFVY LAYVSGVGNM YLPSESVAST TSSPVGRVAI PARIANPSPP        60
     APAPLVDERP EPAPEPRASP APTSPAVVRD DRKDEGRKLP MECPMVDVAD PENVAAVARS       120
     LGDASDVVVF ATQDIEHWRA EFLVNVILNL MSVNVTSVVT VGRHKHTCES ARRDNPDVVR       180
     CCVYSTWLDG HDALKRWTLA EDHAYVLWLI RYRFALDIMR AGEVGVLVSD SDMWFERDPF       240
     ELLKDAATGL GTHSVVANVE GEPFPSMNGG LVYFRADLPG KGGRYLLEVF NDHVDDLLAD       300
     ESPPECHKEQ GVGTQVVWGA MMDQDILRDA AETAVAGAPL WWSYTHHVCL FKGGYDEATK       360
     AKMEIKSKHP ETLDWSRSGR SLPRPFQSHP AVEALGDEHP LNESEEKYGI MKVPNYETWR       420
     NLTILAAPKW MFANHGDGDG WFALRPRPGA AFHCMSQNQG IKPRMLRAYD MWHWDVLGAG       480
     RGIRVGQGRY LSLASAAFGH FTKRGEFAMQ AHRLAALAAA TGRIPVLPMI PCASPWLDDW       540
     RRPDDCYAGV LERINVLAGT CPVTALRQFQ GPDAAYPGDP AAEGSVGSPC CYFVPPGDDC       600
     EEKFAAWGAE MTGEDPHNRP GRTVRLDAII DAAQLVVDAG DATEYADRSW VLGDDFPPDN       660
     AKHPTDVFVD FGRVVKAIEG DGDQNTPWVE IDMRGKDALP RVVTQRGVDD KSRRKWFMDY       720
     NAACPLVNRV SPMV                                                         734
//

If you have problems or comments...

PBIL Back to PBIL home page