(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE343

MICSR_1.PE343        Location/Qualifiers
FT   CDS             complement(667974..668336)
FT                   /codon_start=1
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636973"
FT                   /orf_name="MICPUN_56920"
FT                   /product="Predicted protein"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO62191.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG716384"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniParc:UPI000199A7CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M0"
FT                   /transl_table=1
FT                   /translation="MMNEAARPIVSLYRQILRAHYKCLPPPMRVLGDGYAREEFRRHLD
FT                   SKSMTNDRWIEFASEWSRYLANVAPKEEGAGPKFTGELSKETIDAMSEEQRMMLRKLKE
FT                   EAQSFGESVKADEETK"
     MMNEAARPIV SLYRQILRAH YKCLPPPMRV LGDGYAREEF RRHLDSKSMT NDRWIEFASE        60
     WSRYLANVAP KEEGAGPKFT GELSKETIDA MSEEQRMMLR KLKEEAQSFG ESVKADEETK       120
//

If you have problems or comments...

PBIL Back to PBIL home page