(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE345

MICSR_1.PE345        Location/Qualifiers
FT   CDS             join(669430..669562,669808..669979,670325..670904)
FT                   /codon_start=1
FT                   /gene_family="HOG000264687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636975"
FT                   /orf_name="MICPUN_56922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61765.1"
FT                   /db_xref="UniParc:UPI000199A829"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M2"
FT                   /transl_table=1
FT                   /translation="MANMANMFALLDEDAPKAAPAKENKPAAAAAPAKKAPAKTGDKPA
FT                   GNRNNGNAKRAPRAPREFEGSVEGTEGGRSRPRNADRRKPKDGEGGRRDRADRSGRGHE
FT                   GPHRGGAGKGGWGKPGDELNAPKEGDDAEPEPEPEEPDNEISIEDFEAAKAAKKAALNA
FT                   AMAKGATAKEVDSSAFASMTLAAKSEDVNEFSLDGAGPKAKRERERKAKEAAKLELGFK
FT                   SAPTAPAEDRPARGPGGRGGRGDRREGAGRGGRGEGRGGRGGRGGDRPAGGRGGSGLNV
FT                   KIEDSSAFPTLGK"
     MANMANMFAL LDEDAPKAAP AKENKPAAAA APAKKAPAKT GDKPAGNRNN GNAKRAPRAP        60
     REFEGSVEGT EGGRSRPRNA DRRKPKDGEG GRRDRADRSG RGHEGPHRGG AGKGGWGKPG       120
     DELNAPKEGD DAEPEPEPEE PDNEISIEDF EAAKAAKKAA LNAAMAKGAT AKEVDSSAFA       180
     SMTLAAKSED VNEFSLDGAG PKAKRERERK AKEAAKLELG FKSAPTAPAE DRPARGPGGR       240
     GGRGDRREGA GRGGRGEGRG GRGGRGGDRP AGGRGGSGLN VKIEDSSAFP TLGK             294
//

If you have problems or comments...

PBIL Back to PBIL home page