(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE346

MICSR_1.PE346        Location/Qualifiers
FT   CDS             join(671829..672601,672665..672710,672744..674036)
FT                   /codon_start=1
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636976"
FT                   /orf_name="MICPUN_79742"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO61766.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="HOGENOM:HBG304889"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199A82A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M3"
FT                   /transl_table=1
FT                   /translation="MPSRGASSSVTPREAIAVGDEEAGGAPRDNTGDIIAAKAAAKAAA
FT                   AAATGGSDAYGASSIQVLKGLEPVRKRPGMYIGNTSTKGLHHMVWEVLDNGVDEVQAGH
FT                   ASLITVTVEADGSVAVEDDGRGIPTDVHPATGTSSLETVLTVLHAGGKFGGDESGYHVS
FT                   GGLHGVGISVVNALSDSTEVTVWRGDREYRQSFSRGAALAPMTEGSQDVANVGKKKGTR
FT                   VRFKPDPSIFKERQDFDPNIILARMKELAFLNSTATDEASMDEGDVKKTEEYYEEVLSF
FT                   PGGLKDYVVDLNEGAEPLHEPITFRAEVDGVQVEGALQWTKEAYTDTLLGYANSIRTSD
FT                   GGTHLDGLKQSLTRAVNTQARKAKLLKEADANLGGEHIREGLSAVIAVWVPQPEFEGQT
FT                   KTRLGNPEVRKVVESVIGEQVSEHLEFYPNTLGSIFSKASQAQKAAEAAKRARELVRRK
FT                   SVLRSGSLPGKLSDCSVSDPESTEIFLVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVE
FT                   RKDEASMYKNTEISSMVTALGLGLKGEPFDESQLRYSKIVILTDADVDGAHIRTLLLTF
FT                   LFRYQRGLFEQGKVYVAVPPLYKVESGRAGKNNPPTYCYDEAQLQAHLATLPEGASRSI
FT                   QRFKGLGEMMPEQLWSTTLNPETRLLKRLTVDDAAMANKTFQLLMSDKVAPRREFIETE
FT                   GPKLEDIDV"
     MPSRGASSSV TPREAIAVGD EEAGGAPRDN TGDIIAAKAA AKAAAAAATG GSDAYGASSI        60
     QVLKGLEPVR KRPGMYIGNT STKGLHHMVW EVLDNGVDEV QAGHASLITV TVEADGSVAV       120
     EDDGRGIPTD VHPATGTSSL ETVLTVLHAG GKFGGDESGY HVSGGLHGVG ISVVNALSDS       180
     TEVTVWRGDR EYRQSFSRGA ALAPMTEGSQ DVANVGKKKG TRVRFKPDPS IFKERQDFDP       240
     NIILARMKEL AFLNSTATDE ASMDEGDVKK TEEYYEEVLS FPGGLKDYVV DLNEGAEPLH       300
     EPITFRAEVD GVQVEGALQW TKEAYTDTLL GYANSIRTSD GGTHLDGLKQ SLTRAVNTQA       360
     RKAKLLKEAD ANLGGEHIRE GLSAVIAVWV PQPEFEGQTK TRLGNPEVRK VVESVIGEQV       420
     SEHLEFYPNT LGSIFSKASQ AQKAAEAAKR ARELVRRKSV LRSGSLPGKL SDCSVSDPES       480
     TEIFLVEGDS AGGSAKQGRD RRFQAVLPLR GKILNVERKD EASMYKNTEI SSMVTALGLG       540
     LKGEPFDESQ LRYSKIVILT DADVDGAHIR TLLLTFLFRY QRGLFEQGKV YVAVPPLYKV       600
     ESGRAGKNNP PTYCYDEAQL QAHLATLPEG ASRSIQRFKG LGEMMPEQLW STTLNPETRL       660
     LKRLTVDDAA MANKTFQLLM SDKVAPRREF IETEGPKLED IDV                         703
//

If you have problems or comments...

PBIL Back to PBIL home page