(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE347

MICSR_1.PE347        Location/Qualifiers
FT   CDS             674186..674542
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636977"
FT                   /orf_name="MICPUN_56924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61767.1"
FT                   /db_xref="UniParc:UPI000199A82B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M4"
FT                   /transl_table=1
FT                   /translation="MASLRLSSVTGSGLLLRTGGGSGGGRAGGGRWQSHWQPTTRSTSS
FT                   SSSSSSSSSSSSSSCSTTTTSSSSSGIRSSLCARRPRMFCPQNNPERQPPGRSCSCLSL
FT                   RRLITLYSYCSPSS"
     MASLRLSSVT GSGLLLRTGG GSGGGRAGGG RWQSHWQPTT RSTSSSSSSS SSSSSSSSSC        60
     STTTTSSSSS GIRSSLCARR PRMFCPQNNP ERQPPGRSCS CLSLRRLITL YSYCSPSS         118
//

If you have problems or comments...

PBIL Back to PBIL home page