(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE348

MICSR_1.PE348        Location/Qualifiers
FT   CDS             join(complement(676280..676282),complement(675803..675961),
FT                   complement(675001..675555))
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636978"
FT                   /orf_name="MICPUN_106801"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO62193.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI000199A82C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M5"
FT                   /transl_table=1
FT                   /translation="MPAVPETALKRRKRDEAWAANKAKAAAEAKAKAEANKKEIFNRAE
FT                   KYVKEYRDQEADLVRLKREARAKGGFYVEPEAKVMFVMRLRGINDMHPKTRKIMQLLRL
FT                   RQIHNGVFMRVNKATINMLRKVEPYVMFGYPNLKSVKELIYKRGYGKVNKQRIPLTDNS
FT                   IIEKALGEKGIICIEDLIHEIYTCGPHFTACSNFLWPFKLSAPLGGMTKKRLHYIEGGE
FT                   AGNREDKINALIRRMN"
     MPAVPETALK RRKRDEAWAA NKAKAAAEAK AKAEANKKEI FNRAEKYVKE YRDQEADLVR        60
     LKREARAKGG FYVEPEAKVM FVMRLRGIND MHPKTRKIMQ LLRLRQIHNG VFMRVNKATI       120
     NMLRKVEPYV MFGYPNLKSV KELIYKRGYG KVNKQRIPLT DNSIIEKALG EKGIICIEDL       180
     IHEIYTCGPH FTACSNFLWP FKLSAPLGGM TKKRLHYIEG GEAGNREDKI NALIRRMN         238
//

If you have problems or comments...

PBIL Back to PBIL home page