(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE349

MICSR_1.PE349        Location/Qualifiers
FT   CDS             join(676751..676843,676963..677072,677214..677823)
FT                   /codon_start=1
FT                   /gene_family="HOG000264682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636979"
FT                   /orf_name="MICPUN_56926"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61768.1"
FT                   /db_xref="HOGENOM:HBG560154"
FT                   /db_xref="InterPro:IPR005491"
FT                   /db_xref="UniParc:UPI000199A82D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M6"
FT                   /transl_table=1
FT                   /translation="MGAGVGEQVRKLELDAYQAFLKVTAVTGMSWERDDLATKLRQELN
FT                   ISNDDHTRIREKLSDDERIKTIRENWKQREINQAAKKARIDAGGFTGAKTPKAPASAKP
FT                   KAAPKAKTPKGPAAAPIVVNELICRRVQRFWPDEGGWFDAIITDYRPTTNEHCLTYEIN
FT                   TPNETFEWADISQFDGREFKLLEDRVNIEDLKFYSQGMKVGAETATHNQAIVATHAAVG
FT                   DVNKIVQKAAKTADVDKIVEAKGTLSAQEEALRAQLAALDSDSDSDED"
     MGAGVGEQVR KLELDAYQAF LKVTAVTGMS WERDDLATKL RQELNISNDD HTRIREKLSD        60
     DERIKTIREN WKQREINQAA KKARIDAGGF TGAKTPKAPA SAKPKAAPKA KTPKGPAAAP       120
     IVVNELICRR VQRFWPDEGG WFDAIITDYR PTTNEHCLTY EINTPNETFE WADISQFDGR       180
     EFKLLEDRVN IEDLKFYSQG MKVGAETATH NQAIVATHAA VGDVNKIVQK AAKTADVDKI       240
     VEAKGTLSAQ EEALRAQLAA LDSDSDSDED                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page