(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE35

MICSR_1.PE35         Location/Qualifiers
FT   CDS             join(62719..62808,62902..63022,63113..63387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636040"
FT                   /orf_name="MICPUN_56608"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61601.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199AB2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R2"
FT                   /transl_table=1
FT                   /translation="MSAFVQSAFTTGGSTFVRARPQTRRAPATRASGRVSLRVQAIAEG
FT                   RQSLFVAVTVKSGKMEEYEKLIKRHITNCYMNDRCMYFDFGVNQDGSDPNVVYLYEVYE
FT                   DEAALQEHRDSSHLKEYLSAAAELTDSHDVRTLNLAPYGSVNCNYAGQCEIGEGMWD"
     MSAFVQSAFT TGGSTFVRAR PQTRRAPATR ASGRVSLRVQ AIAEGRQSLF VAVTVKSGKM        60
     EEYEKLIKRH ITNCYMNDRC MYFDFGVNQD GSDPNVVYLY EVYEDEAALQ EHRDSSHLKE       120
     YLSAAAELTD SHDVRTLNLA PYGSVNCNYA GQCEIGEGMW D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page