(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE350

MICSR_1.PE350        Location/Qualifiers
FT   CDS             complement(677928..678767)
FT                   /codon_start=1
FT                   /gene_family="HOG000237461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636980"
FT                   /orf_name="MICPUN_79533"
FT                   /product="Glycosyltransferase family 2 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO62194.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG477361"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199A82E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M7"
FT                   /transl_table=1
FT                   /translation="MRLSVVVPALNEERNVARAVASAREGAGAADHFEVVVVDGGSDDA
FT                   TVSVAHSAGADAVLVSPERGRAAQLARGVERCSGDVIVFLHADSTLPDGYAEKLRDAMK
FT                   PEHSWGAFGFRLAPEERDDDDDAADPSTAARGSKGPGGGTARRFLEWCVDKRTKWLGAP
FT                   YGDQGVWVKRHALDSVGGVPQQCFMEDYELVKRLRRRHGMPCVVDAAVTTSSRRWDAMG
FT                   VARVTALNQLIVFGYAMGVAPERLARWYTAGRNMGGGTKRWDTRAEANAEATKVEER"
     MRLSVVVPAL NEERNVARAV ASAREGAGAA DHFEVVVVDG GSDDATVSVA HSAGADAVLV        60
     SPERGRAAQL ARGVERCSGD VIVFLHADST LPDGYAEKLR DAMKPEHSWG AFGFRLAPEE       120
     RDDDDDAADP STAARGSKGP GGGTARRFLE WCVDKRTKWL GAPYGDQGVW VKRHALDSVG       180
     GVPQQCFMED YELVKRLRRR HGMPCVVDAA VTTSSRRWDA MGVARVTALN QLIVFGYAMG       240
     VAPERLARWY TAGRNMGGGT KRWDTRAEAN AEATKVEER                              279
//

If you have problems or comments...

PBIL Back to PBIL home page