(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE351

MICSR_1.PE351        Location/Qualifiers
FT   CDS             join(678958..680351,680392..680428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636981"
FT                   /orf_name="MICPUN_56928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61769.1"
FT                   /db_xref="UniParc:UPI000199A82F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M8"
FT                   /transl_table=1
FT                   /translation="MRLTCALLVMMFSVTRAVGASSVSSWAAVACPSRVVTKEDVGKPI
FT                   VLLGAWVRAGNGTDGSKDRHPSIASLRITSNPRHGALYWRAKPVLEGDAVPAEMGWERC
FT                   SEVSSRAFADAWPVGDPPLATPEWPCDVVVNANAPSPTHAAAAAAGVVVQPICAEVLYA
FT                   PDANYHNWPSGVDALGNRRVPGSNPTRDEAPDAFGFEFDLVAGDASAAGGAGGAADAMS
FT                   SSAASAASVLVAAVPDAPALTYTAAPIEDGDVAREGDRPALHAALLTRTRVRGIALRDV
FT                   DEGSFAVTVRIQSAVGNYVSVAGAGADVLARAVNPFRLGDGVMDAGVMEFTALPEDAAR
FT                   MLAALEYVHVVDDVYDERGYATDTVTVTATGGACLRSDDSFDDFSDAGEVTRCPRAADV
FT                   GATSVYVKVIVSGRVKDLGERSDPAWRRGFSSLLPIAASLAAATAWSAFAMWSGCAWAL
FT                   ERAGLGGAALGRRRARGA"
     MRLTCALLVM MFSVTRAVGA SSVSSWAAVA CPSRVVTKED VGKPIVLLGA WVRAGNGTDG        60
     SKDRHPSIAS LRITSNPRHG ALYWRAKPVL EGDAVPAEMG WERCSEVSSR AFADAWPVGD       120
     PPLATPEWPC DVVVNANAPS PTHAAAAAAG VVVQPICAEV LYAPDANYHN WPSGVDALGN       180
     RRVPGSNPTR DEAPDAFGFE FDLVAGDASA AGGAGGAADA MSSSAASAAS VLVAAVPDAP       240
     ALTYTAAPIE DGDVAREGDR PALHAALLTR TRVRGIALRD VDEGSFAVTV RIQSAVGNYV       300
     SVAGAGADVL ARAVNPFRLG DGVMDAGVME FTALPEDAAR MLAALEYVHV VDDVYDERGY       360
     ATDTVTVTAT GGACLRSDDS FDDFSDAGEV TRCPRAADVG ATSVYVKVIV SGRVKDLGER       420
     SDPAWRRGFS SLLPIAASLA AATAWSAFAM WSGCAWALER AGLGGAALGR RRARGA           476
//

If you have problems or comments...

PBIL Back to PBIL home page