(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE352

MICSR_1.PE352        Location/Qualifiers
FT   CDS             complement(<680971..>681759)
FT                   /codon_start=1
FT                   /gene_family="HOG000231240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636982"
FT                   /orf_name="MICPUN_70072"
FT                   /product="Predicted protein"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="ACO62195.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG596746"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000199A830"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M9"
FT                   /transl_table=1
FT                   /translation="LEEREDPPEVMMEHVAVLVELIRQRGTFVMHTGAGFSTAAAIPDF
FT                   RGRDGIWTQQAKGRAVPMPRFENTKPTKAHLAAVALHDAGYLTHVVTQNVDGLHQRAGM
FT                   PQHAVSELHGSVFRELCRNEHCPMGPTPRDRTYHRAFDVTSTKRHNGRHRHRTGRRCDA
FT                   CGGDLHDVVVQFGEHLDDETLKTAIAASEASPLALVCGTSLKVPPASTLPRRSGALVVC
FT                   NLQWTSQDKHAALKIHARCDDVMLAVCGHLGIDVPEYDPSR"
     LEEREDPPEV MMEHVAVLVE LIRQRGTFVM HTGAGFSTAA AIPDFRGRDG IWTQQAKGRA        60
     VPMPRFENTK PTKAHLAAVA LHDAGYLTHV VTQNVDGLHQ RAGMPQHAVS ELHGSVFREL       120
     CRNEHCPMGP TPRDRTYHRA FDVTSTKRHN GRHRHRTGRR CDACGGDLHD VVVQFGEHLD       180
     DETLKTAIAA SEASPLALVC GTSLKVPPAS TLPRRSGALV VCNLQWTSQD KHAALKIHAR       240
     CDDVMLAVCG HLGIDVPEYD PSR                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page