(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE353

MICSR_1.PE353        Location/Qualifiers
FT   CDS             682105..682584
FT                   /codon_start=1
FT                   /gene_family="HOG000264683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636983"
FT                   /orf_name="MICPUN_56930"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61770.1"
FT                   /db_xref="HOGENOM:HBG560157"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199A831"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N0"
FT                   /transl_table=1
FT                   /translation="MAGTTAEDEDRDRRPRKSPFQKLRREQRSLLCFVQALVGHLVVIE
FT                   TRDDVTTRGTLVEVDERMNCTLEGAQRVTVEQALEKKNSKFDRMFVRARLIRYVHVPAR
FT                   VDPAELIERRRQEEFDASRHYQAKVVFGPINPSPYDNSEEAQKIRAERAKGYAKH"
     MAGTTAEDED RDRRPRKSPF QKLRREQRSL LCFVQALVGH LVVIETRDDV TTRGTLVEVD        60
     ERMNCTLEGA QRVTVEQALE KKNSKFDRMF VRARLIRYVH VPARVDPAEL IERRRQEEFD       120
     ASRHYQAKVV FGPINPSPYD NSEEAQKIRA ERAKGYAKH                              159
//

If you have problems or comments...

PBIL Back to PBIL home page