(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE355

MICSR_1.PE355        Location/Qualifiers
FT   CDS             684953..685579
FT                   /codon_start=1
FT                   /gene_family="HOG000264685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636985"
FT                   /orf_name="MICPUN_56932"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61771.1"
FT                   /db_xref="HOGENOM:HBG560158"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniParc:UPI000199A833"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N2"
FT                   /transl_table=1
FT                   /translation="MSASLRAAAPVARPRAPVRFRRRAPAVIRAATTADADSPPYQVAA
FT                   RKDLYELRIYGGHYVCRAPYNNREKGLAALMSYIEGGNEESKTFPATQPLIMRYECAPG
FT                   TEDVVGKTMELSLGAGVADPPASAEPEAVGVAAAGGELVAVVGFEGVATPELAGEYRRL
FT                   LTAAIRSDGLELAEPDGFRLATYGQLYSLKPRLNELMLKVKPPGA"
     MSASLRAAAP VARPRAPVRF RRRAPAVIRA ATTADADSPP YQVAARKDLY ELRIYGGHYV        60
     CRAPYNNREK GLAALMSYIE GGNEESKTFP ATQPLIMRYE CAPGTEDVVG KTMELSLGAG       120
     VADPPASAEP EAVGVAAAGG ELVAVVGFEG VATPELAGEY RRLLTAAIRS DGLELAEPDG       180
     FRLATYGQLY SLKPRLNELM LKVKPPGA                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page