(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE356

MICSR_1.PE356        Location/Qualifiers
FT   CDS             complement(685629..686441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636986"
FT                   /orf_name="MICPUN_99453"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62197.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199A834"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N3"
FT                   /transl_table=1
FT                   /translation="MEVPHSPHWSPLKDLTRISDAGATEDERTVHASVELKSTETEIKS
FT                   HRCPICYQTMLMPKRAPNILMPCGHTFCNACLNARDDPRCRTCGDRWRHRVPNHQLQTT
FT                   IQAYVDATATAAASFEDSVIWTSGDRGAPVASSSFDAALARAHVRCEQLRERMREGEAA
FT                   QTAALHREDVEARHLLVLQCDEDNARVRLAEVARELREAHAAVEAQRAVCAGIANEVRI
FT                   HGSSVRSAGEALAAVERGRERLVAEAEGSADGRTKPATLPGTHTAVSR"
     MEVPHSPHWS PLKDLTRISD AGATEDERTV HASVELKSTE TEIKSHRCPI CYQTMLMPKR        60
     APNILMPCGH TFCNACLNAR DDPRCRTCGD RWRHRVPNHQ LQTTIQAYVD ATATAAASFE       120
     DSVIWTSGDR GAPVASSSFD AALARAHVRC EQLRERMREG EAAQTAALHR EDVEARHLLV       180
     LQCDEDNARV RLAEVARELR EAHAAVEAQR AVCAGIANEV RIHGSSVRSA GEALAAVERG       240
     RERLVAEAEG SADGRTKPAT LPGTHTAVSR                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page