(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE358

MICSR_1.PE358        Location/Qualifiers
FT   CDS             join(688189..688287,688443..689825)
FT                   /codon_start=1
FT                   /gene_family="HOG000177308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636988"
FT                   /orf_name="MICPUN_56935"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO61773.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG315290"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N5"
FT                   /transl_table=1
FT                   /translation="MFCSISGTTPEDPVISSKTGHLYERSLITKALQETGECPVTKTPM
FT                   TLEDLLPVKSSTTVKPRTTAAASIPGLLSIFHNEWDALMLETHELRVDLHGTRQELSHA
FT                   LYQHDAACRVISRLMKERDEAREALANARAAGPSAAPGKRAMSSDAMDVDGDAPGGDGK
FT                   KQRSGVPPEAIDAMTAKSKELSKARKKREISPTLASAEDIGKMEVGAIAPCHATKAKGI
FT                   RAVCVNPLNADEVATGGADGSLALFDAAKGKRGALMTGHKKAVTDVAYAGDAILTSSAD
FT                   KTVKIWRGGAEVAALAGVHEGEVVAVSAHPTNAYAVSIGGDGAWAFVDVGAAECLSVQR
FT                   DADSEYTCGGFHPDGLILGTGAADSSVKIWDVKTSKVAAKVEGHVGAVSAMSFSENGYY
FT                   LATCANDGVKLWDLRKLKNFKSVEAAGVRCVRFDHSGHYLAVGGADACVHNVKAEWEVV
FT                   KRWEASKAPVNALEFAADAKALYAGCSDHNLRVIA"
     MFCSISGTTP EDPVISSKTG HLYERSLITK ALQETGECPV TKTPMTLEDL LPVKSSTTVK        60
     PRTTAAASIP GLLSIFHNEW DALMLETHEL RVDLHGTRQE LSHALYQHDA ACRVISRLMK       120
     ERDEAREALA NARAAGPSAA PGKRAMSSDA MDVDGDAPGG DGKKQRSGVP PEAIDAMTAK       180
     SKELSKARKK REISPTLASA EDIGKMEVGA IAPCHATKAK GIRAVCVNPL NADEVATGGA       240
     DGSLALFDAA KGKRGALMTG HKKAVTDVAY AGDAILTSSA DKTVKIWRGG AEVAALAGVH       300
     EGEVVAVSAH PTNAYAVSIG GDGAWAFVDV GAAECLSVQR DADSEYTCGG FHPDGLILGT       360
     GAADSSVKIW DVKTSKVAAK VEGHVGAVSA MSFSENGYYL ATCANDGVKL WDLRKLKNFK       420
     SVEAAGVRCV RFDHSGHYLA VGGADACVHN VKAEWEVVKR WEASKAPVNA LEFAADAKAL       480
     YAGCSDHNLR VIA                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page