(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE359

MICSR_1.PE359        Location/Qualifiers
FT   CDS             join(complement(692259..692339),complement(690471..692117))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636989"
FT                   /orf_name="MICPUN_99456"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62198.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A837"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N6"
FT                   /transl_table=1
FT                   /translation="MTTDGDPRGLPNSHVEGISEGQILSMEGDELAAHDNLEEALDRYD
FT                   RALLADRKQHGDTHPDVAARYCSIGGLYKATGDNEMAREYFAKALEVEESTGTDGRRTA
FT                   RASYMSNLAAVSRAAGDVDLARDQYCTALDHLRGMIPDSNEAVETALSREEASLFRVSG
FT                   DTSTSGYGIGGEGVAAPSPKLLGEGGVLNVAASILNNLGLLLKSIGRLHAARRCYVRAI
FT                   SLGAVALGAHSPAIALRVRNLGAVLLQLGYVDLAVERLTRAHGACVLGHGADHPETIMC
FT                   AEWLQAATETADLDAHAHAHARGVGSDPDETLPEAAEWFCERLRCGVLEPTPEPSLPGE
FT                   ERAIEAIDPAPIGLEDAMVPAVEHATRDAEAAGVGHSHAGTGKTFGVGTPGLDASESQT
FT                   RFNPVEPPPGEDMLSPYAAPVTSRELKRVGNAETSPVWRAVALEHEAIVSGKSSMPRGQ
FT                   DYISAYLRQAPGYANLITPFQEMPSDLLMPYASFRGYGAPLKSGAARQGKGEPRRHQLP
FT                   KRTLDERGVASSAGTAPRPRAIEVREEEEETTPVAQVGLGGRAGESRSGGRNMYAYPD"
     MTTDGDPRGL PNSHVEGISE GQILSMEGDE LAAHDNLEEA LDRYDRALLA DRKQHGDTHP        60
     DVAARYCSIG GLYKATGDNE MAREYFAKAL EVEESTGTDG RRTARASYMS NLAAVSRAAG       120
     DVDLARDQYC TALDHLRGMI PDSNEAVETA LSREEASLFR VSGDTSTSGY GIGGEGVAAP       180
     SPKLLGEGGV LNVAASILNN LGLLLKSIGR LHAARRCYVR AISLGAVALG AHSPAIALRV       240
     RNLGAVLLQL GYVDLAVERL TRAHGACVLG HGADHPETIM CAEWLQAATE TADLDAHAHA       300
     HARGVGSDPD ETLPEAAEWF CERLRCGVLE PTPEPSLPGE ERAIEAIDPA PIGLEDAMVP       360
     AVEHATRDAE AAGVGHSHAG TGKTFGVGTP GLDASESQTR FNPVEPPPGE DMLSPYAAPV       420
     TSRELKRVGN AETSPVWRAV ALEHEAIVSG KSSMPRGQDY ISAYLRQAPG YANLITPFQE       480
     MPSDLLMPYA SFRGYGAPLK SGAARQGKGE PRRHQLPKRT LDERGVASSA GTAPRPRAIE       540
     VREEEEETTP VAQVGLGGRA GESRSGGRNM YAYPD                                  575
//

If you have problems or comments...

PBIL Back to PBIL home page