(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE36

MICSR_1.PE36         Location/Qualifiers
FT   CDS             join(complement(64692..64727),complement(63593..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636041"
FT                   /orf_name="MICPUN_56609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62047.1"
FT                   /db_xref="HOGENOM:HBG525604"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AB2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R3"
FT                   /transl_table=1
FT                   /translation="MRPILLKGHERCYNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIG
FT                   HNGAVWTCDVTEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMV
FT                   ISSDPFMGVPAALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDG
FT                   VIRLWDVETGKIVHEANDHKKQIQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYA
FT                   ADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFG
FT                   PINALAWHPDGRSFTSGGEDGYVRIHHFDNDYFRIK"
     MRPILLKGHE RCYNKEGDLL FTCAKDHHPT LWYSDDGERV GTYIGHNGAV WTCDVTEDSK        60
     TLVTGSADTT CKMWDTETGT CYFTHQFEQP VRAVALSKGD QHMVISSDPF MGVPAALHIV       120
     DVAANREEQT NEIKISMSGP EGRINRALWG PLNRTILTGG EDGVIRLWDV ETGKIVHEAN       180
     DHKKQIQHLS LSVDKTHFIS ASLDKTAKLF DSETLECLKT YAADRPVNAA ILSPILDHII       240
     LGGGQDAMAV TTTHSKAGKF DSKIFYKIYE EEIGGIRGHF GPINALAWHP DGRSFTSGGE       300
     DGYVRIHHFD NDYFRIK                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page