(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE360

MICSR_1.PE360        Location/Qualifiers
FT   CDS             692526..695225
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636990"
FT                   /orf_name="MICPUN_99457"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61774.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A8A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N7"
FT                   /transl_table=1
FT                   /translation="MASSFKWDHPNGRGVLLPGQTHCHTGKLVPFDDYDLDATCELVCS
FT                   PCGRFPDPDAPVRVKGTAHLAGAMVGKSADKENRDARTNVPPMETAGWALMGCKPCGSA
FT                   KRWSCCGTCAGGCRMWSEEGYVMTGGPKPPDDDADATDDDDGAPKLGGPLEGTPDAAEF
FT                   ASWDGCVAIPTPAVVPLPEPRLEGAHGERIARLTVGRGAVTCIAVSGCGTRMACGGSDG
FT                   SCVVYAIDPSADDLAPEFLCAAYPGKPLTKPRTRRQKNANAVVCLDSDSDVEDPTEAGL
FT                   DADELAEKRERDAAEAARVESEVTEGGHAGAVSCVAFHPDAASFYTASADGTCKRWKIP
FT                   VVSNSAHATALMSTYAHKRTEERGAVRCLRVSDDGARLYVGGEEACLAVYDAGSGDVIA
FT                   RTYSPRWPEKDKDGLGVPPVDDEDEDPEAAEKAAKAAEARAEREAAMTPEELAAVLDAE
FT                   AAAAEAKAKYLEEKRYRNKPKGFGGVNTVLCIAGGAGESGDLVFTGSRDCNVRRWAVSG
FT                   DAPVVERVIPGHKAPVTAIAVSRDGSELVTGGARGDGELRHYRWQPVAGVDAEYVDGKL
FT                   KSSAGSYVRVRTIRRGPEGFKESAHPAGVLAALISPDERYLYTVGANEGGVEVAISRWS
FT                   VETGAEDKDFRIETNHQGGVTSLCLFPDVAPPGSDAAVGVAAVTRATAARAGGRILTGG
FT                   ADGCVDLWTAERHDDGAGQQLAAEIAQQEAAMTATEYQRAQVKLTALSPELSRPAMAAR
FT                   GRKELPALEAAKFPIDEETGTKKDLEDFTVEDFEPFTSKELISMCCAHGLLFIDPKKPP
FT                   ESKRAIAERMVAFFREEKEKARIAAREERMGLAQPAKLRARPRIPGIESPEEKKKPTSG
FT                   DEESEASETEVSETELSETEEEAKKDDE"
     MASSFKWDHP NGRGVLLPGQ THCHTGKLVP FDDYDLDATC ELVCSPCGRF PDPDAPVRVK        60
     GTAHLAGAMV GKSADKENRD ARTNVPPMET AGWALMGCKP CGSAKRWSCC GTCAGGCRMW       120
     SEEGYVMTGG PKPPDDDADA TDDDDGAPKL GGPLEGTPDA AEFASWDGCV AIPTPAVVPL       180
     PEPRLEGAHG ERIARLTVGR GAVTCIAVSG CGTRMACGGS DGSCVVYAID PSADDLAPEF       240
     LCAAYPGKPL TKPRTRRQKN ANAVVCLDSD SDVEDPTEAG LDADELAEKR ERDAAEAARV       300
     ESEVTEGGHA GAVSCVAFHP DAASFYTASA DGTCKRWKIP VVSNSAHATA LMSTYAHKRT       360
     EERGAVRCLR VSDDGARLYV GGEEACLAVY DAGSGDVIAR TYSPRWPEKD KDGLGVPPVD       420
     DEDEDPEAAE KAAKAAEARA EREAAMTPEE LAAVLDAEAA AAEAKAKYLE EKRYRNKPKG       480
     FGGVNTVLCI AGGAGESGDL VFTGSRDCNV RRWAVSGDAP VVERVIPGHK APVTAIAVSR       540
     DGSELVTGGA RGDGELRHYR WQPVAGVDAE YVDGKLKSSA GSYVRVRTIR RGPEGFKESA       600
     HPAGVLAALI SPDERYLYTV GANEGGVEVA ISRWSVETGA EDKDFRIETN HQGGVTSLCL       660
     FPDVAPPGSD AAVGVAAVTR ATAARAGGRI LTGGADGCVD LWTAERHDDG AGQQLAAEIA       720
     QQEAAMTATE YQRAQVKLTA LSPELSRPAM AARGRKELPA LEAAKFPIDE ETGTKKDLED       780
     FTVEDFEPFT SKELISMCCA HGLLFIDPKK PPESKRAIAE RMVAFFREEK EKARIAAREE       840
     RMGLAQPAKL RARPRIPGIE SPEEKKKPTS GDEESEASET EVSETELSET EEEAKKDDE        899
//

If you have problems or comments...

PBIL Back to PBIL home page