(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE361

MICSR_1.PE361        Location/Qualifiers
FT   CDS             complement(695284..696183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636991"
FT                   /orf_name="MICPUN_99458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62199.1"
FT                   /db_xref="UniParc:UPI000199A8A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N8"
FT                   /transl_table=1
FT                   /translation="MAPEKEPLEPSWLAQVKELLGPHKRYHRAQTEDALPSGVKVEQAS
FT                   RFPKEVAHFTRWKIIHIECSRWDADAMMKRAEVHVVDLVDAATIKLNPALHSHALELEA
FT                   ADDGLVVSNRGGFHSKPDAVQKLSDCGCEEATQIMNLVRSCVMYEPGKKARHENDAKVT
FT                   TAWINVCRNGHTHGLHSHEPAKFSAVYYVSVPESKEEEEEEEDSLSGHLVLRFGSGGNE
FT                   GDPALGLEDDSWCLWDHVEPKEGRLVIFPSSMPHGVLKVSTAADEEKPRISIAFNTGEK
FT                   NVNLEKYGKKNKKRKKTE"
     MAPEKEPLEP SWLAQVKELL GPHKRYHRAQ TEDALPSGVK VEQASRFPKE VAHFTRWKII        60
     HIECSRWDAD AMMKRAEVHV VDLVDAATIK LNPALHSHAL ELEAADDGLV VSNRGGFHSK       120
     PDAVQKLSDC GCEEATQIMN LVRSCVMYEP GKKARHENDA KVTTAWINVC RNGHTHGLHS       180
     HEPAKFSAVY YVSVPESKEE EEEEEDSLSG HLVLRFGSGG NEGDPALGLE DDSWCLWDHV       240
     EPKEGRLVIF PSSMPHGVLK VSTAADEEKP RISIAFNTGE KNVNLEKYGK KNKKRKKTE        299
//

If you have problems or comments...

PBIL Back to PBIL home page