(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE362

MICSR_1.PE362        Location/Qualifiers
FT   CDS             696428..697309
FT                   /codon_start=1
FT                   /gene_family="HOG000264703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636992"
FT                   /orf_name="MICPUN_56939"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61775.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG560164"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199A8AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N9"
FT                   /transl_table=1
FT                   /translation="MKTGPPAWAVDASIVFALVYLAGSLELVEPFERYLVPETLPKYSY
FT                   PFTTDQSVPTWTLPFLGVFIPLGLIVSVAAFTGAGWLEIRRSIAGLCVSVSLGWAVTNL
FT                   LKVSIGGYRPDFLYRCWPDGNVAWASPGVPACTPTNPRHVIEGRKSFPSGHSSMSFSGL
FT                   AYAAAYATARLEVFSPYDYGVVGVHPRDRASMLRMALAWWPLALATYVALSRWRDYWHH
FT                   SEDVICGSLLGTGAAYLAWVTKQPLAGAGARGAGGLRREGRDYAPIGAESGEGSADSAR
FT                   LDRMEGRGPRSE"
     MKTGPPAWAV DASIVFALVY LAGSLELVEP FERYLVPETL PKYSYPFTTD QSVPTWTLPF        60
     LGVFIPLGLI VSVAAFTGAG WLEIRRSIAG LCVSVSLGWA VTNLLKVSIG GYRPDFLYRC       120
     WPDGNVAWAS PGVPACTPTN PRHVIEGRKS FPSGHSSMSF SGLAYAAAYA TARLEVFSPY       180
     DYGVVGVHPR DRASMLRMAL AWWPLALATY VALSRWRDYW HHSEDVICGS LLGTGAAYLA       240
     WVTKQPLAGA GARGAGGLRR EGRDYAPIGA ESGEGSADSA RLDRMEGRGP RSE              293
//

If you have problems or comments...

PBIL Back to PBIL home page