(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE363

MICSR_1.PE363        Location/Qualifiers
FT   CDS             complement(697428..699731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636993"
FT                   /orf_name="MICPUN_99459"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62200.1"
FT                   /db_xref="UniParc:UPI000199A8AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P0"
FT                   /transl_table=1
FT                   /translation="MSDPEDEEPAMEEEEEEELEVEEGDEEQFEEGEEGEELEEGEEGE
FT                   MEEGEEGEEDLEEGEEEPEEEPEEGEYEEEDDGDVADEFSEERPDASPEGRKSKSSKGG
FT                   RSSKGPDPEYPTEPESDSDDDALSRRRRKNKLSKAARDPYRFVRDSDDESISSGRDRRG
FT                   GEPWRTKMDGKTEYNTLANEVRNYSMHRPPGPDGRAHRMEDLPVKLAFEHLSSLAGMSE
FT                   KVQNAINLSRNLFQRRVDKMEKGVMFKAWRGWLLVQHDFNNKRNILTRAVNKMKRRRLY
FT                   KAFSKWAELHNKAHRPSHFDKAARAVVLGGCRRRTFGAWREHTKDVRRQFKMAAHTARM
FT                   REEFLERLVEAGLRQVMHKRIRRAWDAFDKFSEVRRAKRNKARQVIGRAMNREQARAFG
FT                   RWREYVAQLNKQHGQLKRAVARMSKATMARAFDAWQGQQLHKKRCLMKIIKGTQARAFA
FT                   KWQDNLRLLRKARIVFARWNQRTRYAAFNGWWLNVEEKRRQTEMCSKICKRILNRAVRN
FT                   AWAQWMYCVEQSFGCTLEQVKALRDQNARLRRDNERFVRLVDSGEWGRGRVEELSEAGR
FT                   LLRDERKQLEDLIRSIKDEKDGFVKDAELQAREARALKDRLVSGNFVQRNKLNVRGGSA
FT                   FNSMQRVLKQDLIDSGAAARQRHMLGGAVHNVDRLAMDKVSVFADGEIQMQAVKRAPPP
FT                   FARGGARRPAPPPLRAAPPPVPMPRTTAPRPASAPRDEEGENVLVEALSSLTADEVDAL
FT                   EDILKRGRTDAALV"
     MSDPEDEEPA MEEEEEEELE VEEGDEEQFE EGEEGEELEE GEEGEMEEGE EGEEDLEEGE        60
     EEPEEEPEEG EYEEEDDGDV ADEFSEERPD ASPEGRKSKS SKGGRSSKGP DPEYPTEPES       120
     DSDDDALSRR RRKNKLSKAA RDPYRFVRDS DDESISSGRD RRGGEPWRTK MDGKTEYNTL       180
     ANEVRNYSMH RPPGPDGRAH RMEDLPVKLA FEHLSSLAGM SEKVQNAINL SRNLFQRRVD       240
     KMEKGVMFKA WRGWLLVQHD FNNKRNILTR AVNKMKRRRL YKAFSKWAEL HNKAHRPSHF       300
     DKAARAVVLG GCRRRTFGAW REHTKDVRRQ FKMAAHTARM REEFLERLVE AGLRQVMHKR       360
     IRRAWDAFDK FSEVRRAKRN KARQVIGRAM NREQARAFGR WREYVAQLNK QHGQLKRAVA       420
     RMSKATMARA FDAWQGQQLH KKRCLMKIIK GTQARAFAKW QDNLRLLRKA RIVFARWNQR       480
     TRYAAFNGWW LNVEEKRRQT EMCSKICKRI LNRAVRNAWA QWMYCVEQSF GCTLEQVKAL       540
     RDQNARLRRD NERFVRLVDS GEWGRGRVEE LSEAGRLLRD ERKQLEDLIR SIKDEKDGFV       600
     KDAELQAREA RALKDRLVSG NFVQRNKLNV RGGSAFNSMQ RVLKQDLIDS GAAARQRHML       660
     GGAVHNVDRL AMDKVSVFAD GEIQMQAVKR APPPFARGGA RRPAPPPLRA APPPVPMPRT       720
     TAPRPASAPR DEEGENVLVE ALSSLTADEV DALEDILKRG RTDAALV                     767
//

If you have problems or comments...

PBIL Back to PBIL home page