(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE364

MICSR_1.PE364        Location/Qualifiers
FT   CDS             complement(701033..702871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636994"
FT                   /orf_name="MICPUN_52217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62201.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000199A8AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P1"
FT                   /transl_table=1
FT                   /translation="MSRKYEPDAVADTPAAASWTHALAGYDETLRSRGSTFRLTFPLDQ
FT                   FKRPIHDPRSTSRATALASAAWYLGVFAFAAFAVYAHVTRPTVTNLVLLPSTALPPLPL
FT                   TLRTRCSSPWACTPGATPLPGATHIGPCRYENPYNRTYACAKHAHNILDGPELDANGAE
FT                   VWPNLTDTPTSAGAGGRRRLLNDHLWTWTRAATATQAYKSPTSRCDAERVATVTSWGAE
FT                   ASALDLTDADPRVYAGFDPDAMARRARDPNAAVDELFAALDEDASGFLDGAELDVLGPF
FT                   ARIMLKLNNFGDYHEGNATFAGGFKDIEDFTGPGSTTGVIERGVVDEMRTYLAGFGYEC
FT                   TWCVTVDDYRNALRYVWDSTKANWNGFVANVDPLYHPWSYVLSGDAFYPTTSVGVDAFP
FT                   KDGRVSPAELREAFRYMLAHQTVTPWAVAQAVSAALDANPDAAESAAMQLCSADVAAGD
FT                   DALGGILVETTFPPGCPYGSESCDTRLTIELGDGKANGMALRLDLEPGQRKAVQVGVTV
FT                   RRERGKPDAYELRADDLFYVGKNDDRRASLRVGVKQYAEALDTARPGTWLTVFAAVGGF
FT                   ASLSLSILSLGVGAIAALAERSESACACLGDAFGRG"
     MSRKYEPDAV ADTPAAASWT HALAGYDETL RSRGSTFRLT FPLDQFKRPI HDPRSTSRAT        60
     ALASAAWYLG VFAFAAFAVY AHVTRPTVTN LVLLPSTALP PLPLTLRTRC SSPWACTPGA       120
     TPLPGATHIG PCRYENPYNR TYACAKHAHN ILDGPELDAN GAEVWPNLTD TPTSAGAGGR       180
     RRLLNDHLWT WTRAATATQA YKSPTSRCDA ERVATVTSWG AEASALDLTD ADPRVYAGFD       240
     PDAMARRARD PNAAVDELFA ALDEDASGFL DGAELDVLGP FARIMLKLNN FGDYHEGNAT       300
     FAGGFKDIED FTGPGSTTGV IERGVVDEMR TYLAGFGYEC TWCVTVDDYR NALRYVWDST       360
     KANWNGFVAN VDPLYHPWSY VLSGDAFYPT TSVGVDAFPK DGRVSPAELR EAFRYMLAHQ       420
     TVTPWAVAQA VSAALDANPD AAESAAMQLC SADVAAGDDA LGGILVETTF PPGCPYGSES       480
     CDTRLTIELG DGKANGMALR LDLEPGQRKA VQVGVTVRRE RGKPDAYELR ADDLFYVGKN       540
     DDRRASLRVG VKQYAEALDT ARPGTWLTVF AAVGGFASLS LSILSLGVGA IAALAERSES       600
     ACACLGDAFG RG                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page