(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE365

MICSR_1.PE365        Location/Qualifiers
FT   CDS             703032..703430
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636995"
FT                   /orf_name="MICPUN_56942"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61776.1"
FT                   /db_xref="UniParc:UPI000199A8AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P2"
FT                   /transl_table=1
FT                   /translation="MNGDDILLKPSAETMSRSTTGDVMPQTEARAYALSLPPAQRSEIS
FT                   GCYCLKCVPCGSFPVAAHCVCGGSSLCWGCGTTPFACFAIPMPFIDPYFRSIKRDCVVM
FT                   VVNAEDQTLACYPGEQAEDPICIWSKLW"
     MNGDDILLKP SAETMSRSTT GDVMPQTEAR AYALSLPPAQ RSEISGCYCL KCVPCGSFPV        60
     AAHCVCGGSS LCWGCGTTPF ACFAIPMPFI DPYFRSIKRD CVVMVVNAED QTLACYPGEQ       120
     AEDPICIWSK LW                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page