(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE366

MICSR_1.PE366        Location/Qualifiers
FT   CDS             complement(703561..704031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636996"
FT                   /orf_name="MICPUN_107908"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62202.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199A8AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P3"
FT                   /transl_table=1
FT                   /translation="MPSSHAQLAAFVATMMTLQYVRRREEFRVFCKWNKRGTSGRAGHA
FT                   DAMTAALVVLAWPLAWTVGISRVYLGYHSVEQVVAGACVGCVFGAAYHELVCLAATKSF
FT                   ARLDVNDGGLGGAVARAVIGARMRDSSLVPDPLEVERVALQVNVLDFKEKSF"
     MPSSHAQLAA FVATMMTLQY VRRREEFRVF CKWNKRGTSG RAGHADAMTA ALVVLAWPLA        60
     WTVGISRVYL GYHSVEQVVA GACVGCVFGA AYHELVCLAA TKSFARLDVN DGGLGGAVAR       120
     AVIGARMRDS SLVPDPLEVE RVALQVNVLD FKEKSF                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page